TkA05G443050 | RubberDandelionOmics

Gene overview

TkA05G443050

Reference: TK1151 Chr: Chr05 Coordinates: 110695895-110697161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · TkA05G443050|TK1151|cDNA

CTCAAGCTATGGTTGGTTTGACATAAATCCCCTGAGATGTCATATTCTCCTCCTTATTGTAACTTGTAACTTGTAACTTGTAAGGTGTTACTTGAGAAATTCTTCGTTTTCTCATGGCGGCGTGGAGGATGCAGAGGCGATTACTATCTCTCTTCACAAGCAGCAGGCAACCTCATGTCTCCCTCCGAAACGATGCCTCTCCCAGTTTTCTTCCTTCTCTCAGTTCATTCCTCGTCGGTGAAGGAATCTACAAACACCAA...

CDS

Download CDS FASTA

576 bp · TkA05G443050|TK1151|CDS

ATGGCGGCGTGGAGGATGCAGAGGCGATTACTATCTCTCTTCACAAGCAGCAGGCAACCTCATGTCTCCCTCCGAAACGATGCCTCTCCCAGTTTTCTTCCTTCTCTCAGTTCATTCCTCGTCGGTGAAGGAATCTACAAACACCAATTCCGATCACTTTCCCAAACCAGCAACCCAAATGTGAAAAACACACTAGAAGATGAAGAAGCTTCGAGCTCAAAATCAAACTCAACCACAGTTATTCCATCTGAAATCGAGAA...

Protein

Download Protein FASTA

191 aa · TkA05G443050|TK1151|PROTEIN

MAAWRMQRRLLSLFTSSRQPHVSLRNDASPSFLPSLSSFLVGEGIYKHQFRSLSQTSNPNVKNTLEDEEASSSKSNSTTVIPSEIEKTEVTFTAKSELKISPRHDLAMMFTCKVCETRSVKTISRESYEKGVVVARCGGCNNYHLIADHLGIFGEKGSIEDILAERGEEIRRGNSDTLNLTLEDLVGMTKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G443050`
TK1151 ID	TkA05G443050
OH-1004 ID	LXL04_022053
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 65.411 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G443050`
Location	Chr05:110695895-110697161 (+)
Description	Similar to dnlz: DNL-type zinc finger protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022053` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0030150 protein import into mitochondrial matrix Biological Process GO:0050821 protein stabilization Biological Process GO:0051131 chaperone-mediated protein complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0044183 protein folding chaperone Molecular Function GO:0051087 protein-folding chaperone binding Molecular Function
KEGG gene cross-reference	dre:791166 hsa:728489 mmu:52838 spo:2542642 xla:779303 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.818

Rank 1 · TkA05G443050 · TK1151

Plastid0.143

Rank 2 · TkA05G443050 · TK1151

Nucleus0.076

Rank 3 · TkA05G443050 · TK1151

Cytoplasm0.052

Rank 4 · TkA05G443050 · TK1151

Cell membrane0.013

Rank 5 · TkA05G443050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05129Zn_ribbon_Elf199-143 aa

PF05180zf-DNL108-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G443050	`PF05129`	Zn_ribbon_Elf1	99	143	0.064	14.1
TkA05G443050	`PF05180`	zf-DNL	108	168	2.4e-27	95.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card