TkA05G441670 | RubberDandelionOmics

Gene overview

TkA05G441670

Reference: TK1151 Chr: Chr05 Coordinates: 110302923-110303389 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA05G441670|TK1151|cDNA

ATGGGTCCGGTTCTGTCTTCTCCGATCAACATTTATATCATCTGGTATGGTAAATGGGTTCCAGCTCAAAAGCTATTGATTAAAGACTTTTTACTATCAATTTCCACCACCAAACGCCGTGCTGCCTCCGCTCCCTCCGTCTCCGACTGGTGGAAAACCGTGACGCTTTACACTGACCAAACCAACGCCAACATCTCCAGCGACGTCCGCGTCGCCGGAGAATATTCCGATCGGAAATACACCCACGGATTTCTGCCGGG...

CDS

Download CDS FASTA

342 bp · TkA05G441670|TK1151|CDS

ATGGGTCCGGTTCTGTCTTCTCCGATCAACATTTATATCATCTGGTATGGTAAATGGGTTCCAGCTCAAAAGCTATTGATTAAAGACTTTTTACTATCAATTTCCACCACCAAACGCCGTGCTGCCTCCGCTCCCTCCGTCTCCGACTGGTGGAAAACCGTGACGCTTTACACTGACCAAACCAACGCCAACATCTCCAGCGACGTCCGCGTCGCCGGAGAATATTCCGATCGGAAATACACCCACGGATTTCTGCCGGG...

Protein

Download Protein FASTA

113 aa · TkA05G441670|TK1151|PROTEIN

MGPVLSSPINIYIIWYGKWVPAQKLLIKDFLLSISTTKRRAASAPSVSDWWKTVTLYTDQTNANISSDVRVAGEYSDRKYTHGFLPGGVWVSLLHIPVESRVHLTIRMGWELR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G441670`
TK1151 ID	TkA05G441670
OH-1004 ID	LXL04_009717
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.451 / OH-1004 24.702 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G441670

Location Chr05:110302923-110303389 (+)

Description Similar to EXL5: Protein EXORDIUM-like 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17230`	May play a role in a brassinosteroid-dependent regulation of growth and development.	No verified direct reference in this release
`At2g35150`	May play a role in a brassinosteroid-dependent regulation of growth and development.	No verified direct reference in this release
`At5g51550`	May play a role in a brassinosteroid-dependent regulation of growth and development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G35140

ath:AT2G17230

ath:AT2G35150

ath:AT4G08950

ath:AT5G51550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.582

Rank 1 · TkA05G441670 · TK1151

Cytoplasm0.110

Rank 2 · TkA05G441670 · TK1151

Nucleus0.070

Rank 3 · TkA05G441670 · TK1151

Lysosome / Vacuole0.060

Rank 4 · TkA05G441670 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA05G441670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04674Phi_11-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G441670	`PF04674`	Phi_1	1	83	2.8e-24	86.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SII5`	Arabidopsis thaliana	sp\|Q9SII5\|EXOL5_ARATH Protein EXORDIUM-like 5	64.300%	Swiss-Prot	High
`O82176`	Arabidopsis thaliana	sp\|O82176\|EXOL7_ARATH Protein EXORDIUM-like 7	51.200%	Swiss-Prot	High
`Q9FHM9`	Arabidopsis thaliana	sp\|Q9FHM9\|EXOL3_ARATH Protein EXORDIUM-like 3	51.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card