TkA05G436690 | RubberDandelionOmics

Gene overview

TkA05G436690

Reference: TK1151 Chr: Chr05 Coordinates: 109026056-109030355 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2427 bp · TkA05G436690|TK1151|cDNA

CTGAGGAGCATAAATGTTGTTCCAGGGACCCAAGAATCGTTGACGTAACGAAGCCCCCAATTCCCAAATGGACCAAACAGCAGAAATTCGTGGTCGTCGACAACCAAAAGGCGTGACGCCCTCTCACCAATTCCAAAAGTCATCTGCCACCGGAGATCTGCCTTTTTTATGGCTATTCGTTGAGACTCCCCGCCGACGGTCCCAGACTTACTCGATTCGGCTTCAGCAGCACAGTCGTTCATCATGAGGACGCCGGCGAG...

CDS

Download CDS FASTA

2028 bp · TkA05G436690|TK1151|CDS

ATGAGGACGCCGGCGAGCCGTACCGTGAAAGTCATACCGTTTCAACACTCGTATGCTGGCGGAGACAGTACGCCGACGGCTTCTTCGTCTTCGTTGTCGAGATGGAGAGCGAAGGTGAACCGGATGAAGATAATTGATTGGATTGATCTCTTTCTCCCTTGCTCACGTTGGATTCGGACTTACCGGTGGCGTGAATATCTCCAGCCTGACGTTGTCTCCGGTGTCACCGTCGGCATCATGCTCGTTCCACAGTCTATGTC...

Protein

Download Protein FASTA

675 aa · TkA05G436690|TK1151|PROTEIN

MRTPASRTVKVIPFQHSYAGGDSTPTASSSSLSRWRAKVNRMKIIDWIDLFLPCSRWIRTYRWREYLQPDVVSGVTVGIMLVPQSMSYAKLAGLQPIYGLYTGLVPIFIYCIFGSSRQLAVGPVALVSLLVSNVLGNVDSSGELYTELAILLSLMVGILECTMGLLRLGWLIRFISHSVISGFTTASAIVIALSQAKYFLGYSIVRSSEIIPLVKSIISGADKFSWPPFVMGLTILAIMLTMKQLGKTRKNLRFLRAAGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G436690`
TK1151 ID	TkA05G436690
OH-1004 ID	LXL04_035016
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.600
Protein coverage (%)	TK1151 99.704 / OH-1004 95.306 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G436690

Location Chr05:109026056-109030355 (+)

Description Similar to SULTR4;1: Sulfate transporter 4.1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13550`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At3g12520`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At4g08620`	May act as a high-affinity H⁺/sulfate symporter mediating root sulfate uptake under low-sulfur conditions.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x
`At4g02700`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G12520

ath:AT3G51895

ath:AT5G13550

cre:CHLRE_17g723350v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.372

Rank 1 · TkA05G436690 · TK1151

Lysosome / Vacuole0.321

Rank 2 · TkA05G436690 · TK1151

Cytoplasm0.132

Rank 3 · TkA05G436690 · TK1151

Endoplasmic reticulum0.119

Rank 4 · TkA05G436690 · TK1151

Golgi apparatus0.099

Rank 5 · TkA05G436690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916Sulfate_transp67-439 aa

PF24341OB_DEPS-1_6th126-139 aa

PF16983MFS_MOT1154-189 aa

PF16983MFS_MOT1231-246 aa

PF16983MFS_MOT1328-413 aa

PF24341OB_DEPS-1_6th400-442 aa

PF01740STAS490-610 aa

PF13466STAS_2546-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G436690	`PF00916`	Sulfate_transp	67	439	5.1e-128	427.8
TkA05G436690	`PF24341`	OB_DEPS-1_6th	126	139	0.21	11.9
TkA05G436690	`PF16983`	MFS_MOT1	154	189	0.00044	21.4
TkA05G436690	`PF16983`	MFS_MOT1	231	246	0.00044	21.4
TkA05G436690	`PF16983`	MFS_MOT1	328	413	0.00044	21.4
TkA05G436690	`PF24341`	OB_DEPS-1_6th	400	442	0.21	11.9
TkA05G436690	`PF01740`	STAS	490	610	1.2e-23	83.6
TkA05G436690	`PF13466`	STAS_2	546	598	7.6e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY46`	Arabidopsis thaliana	sp\|Q9FY46\|SUT41_ARATH Sulfate transporter 4.1, chloroplastic	75.200%	Swiss-Prot	High
`Q8GYH8`	Arabidopsis thaliana	sp\|Q8GYH8\|SUT42_ARATH Probable sulfate transporter 4.2	73.000%	Swiss-Prot	High
`Q9SAY1`	Arabidopsis thaliana	sp\|Q9SAY1\|SUT11_ARATH Sulfate transporter 1.1	37.000%	Swiss-Prot	Medium
`O04289`	Arabidopsis thaliana	sp\|O04289\|SUT32_ARATH Sulfate transporter 3.2	37.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card