TkA05G433010 | RubberDandelionOmics

Gene overview

TkA05G433010

Reference: TK1151 Chr: Chr05 Coordinates: 108029824-108033622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1637 bp · TkA05G433010|TK1151|cDNA

GACTCATTGACGTGGCAAGTAAATCCTTAATTTTCATTTAGGACCAATCACATGTGACAACGTACCACCAATTATCCCTGTTACCAACTCATCTCGTCGTTTTACGACAACTCGCCGCACTTCCCATTTTCAATCAACGTCTCTCCTTACACCTCTTCAGTGGACTAGCATGTAGGTTAATAAACTCGAACTTGGATCTGCATAAGGATGCAAATGCATGTGTATATAAAGGTCGACGAACATATCACGATTTAGCTAAA...

CDS

Download CDS FASTA

1041 bp · TkA05G433010|TK1151|CDS

ATGGCTACACAGGGTACTACTGGAGCCAACAATGTTACTAGCCGACCGCCTCCAAATCCATCTCCACTACGTACTGCGAAGTTTTTCCAGGCCAACATGAGGATATTGGTCACTGGAGGAGCTGGTTTCATTGGCTCTCACCTTGTGGACAGATTGATGCAAAATGAAAAGAACGAGGTGGTGGTTGTAGATAATTACTTCACAGGTTCAAAGGACAATCTAAAACAATGGTTTGGTCACCCAAGATTTGAGCTCATTCG...

Protein

Download Protein FASTA

346 aa · TkA05G433010|TK1151|PROTEIN

MATQGTTGANNVTSRPPPNPSPLRTAKFFQANMRILVTGGAGFIGSHLVDRLMQNEKNEVVVVDNYFTGSKDNLKQWFGHPRFELIRHDVTETLLIEVDQIYHLACPASPIFYKHNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRNEPLTVQAPGTQTRSFCYVSDMVDGLIRLMEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G433010`
TK1151 ID	TkA05G433010
OH-1004 ID	LXL04_017764
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.400
Protein coverage (%)	TK1151 99.711 / OH-1004 92.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G433010

Location Chr05:108029824-108033622 (+)

Description Similar to UXS5: UDP-glucuronic acid decarboxylase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28760`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At5g59290`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	Reconstruction of de novo pathway for synthesis of UDP-glucuronic acid and UDP-xylose from intrinsic UDP-glucose in Saccharomyces cerevisiae.2006 · DOI: 10.1111/j.1742-4658.2006.05281.x
`At3g46440`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At2g47650`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At3g53520`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017764 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019305 dTDP-rhamnose biosynthetic process Biological Process

GO:0033320 UDP-D-xylose biosynthetic process Biological Process

GO:0042732 D-xylose metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G28760

ath:AT2G47650

ath:AT3G46440

ath:AT3G62830

ath:AT5G59290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.650

Rank 1 · TkA05G433010 · TK1151

Nucleus0.304

Rank 2 · TkA05G433010 · TK1151

Mitochondrion0.110

Rank 3 · TkA05G433010 · TK1151

Peroxisome0.082

Rank 4 · TkA05G433010 · TK1151

Plastid0.066

Rank 5 · TkA05G433010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04321RmlD_sub_bind33-298 aa

PF01370Epimerase35-269 aa

PF02719Polysacc_synt_235-142 aa

PF08659KR35-63 aa

PF00106adh_short35-91 aa

PF16363GDP_Man_Dehyd36-332 aa

PF010733Beta_HSD36-188 aa

PF07993NAD_binding_437-61 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G433010	`PF04321`	RmlD_sub_bind	33	298	7.2e-09	35.8
TkA05G433010	`PF01370`	Epimerase	35	269	3.6e-47	161.5
TkA05G433010	`PF02719`	Polysacc_synt_2	35	142	1.1e-13	51.7
TkA05G433010	`PF08659`	KR	35	63	0.17	12.5
TkA05G433010	`PF00106`	adh_short	35	91	0.19	11.9
TkA05G433010	`PF16363`	GDP_Man_Dehyd	36	332	2.6e-50	172.5
TkA05G433010	`PF01073`	3Beta_HSD	36	188	9.5e-13	48.5
TkA05G433010	`PF07993`	NAD_binding_4	37	61	9.2e-12	45.4
TkA05G433010	`PF03435`	Sacchrp_dh_NADP	40	89	0.12	13.4
TkA05G433010	`PF07993`	NAD_binding_4	89	208	9.2e-12	45.4
TkA05G433010	`PF00106`	adh_short	119	132	0.19	11.9
TkA05G433010	`PF08659`	KR	127	148	0.17	12.5
TkA05G433010	`PF02719`	Polysacc_synt_2	175	291	1.1e-13	51.7
TkA05G433010	`PF00106`	adh_short	283	318	0.19	11.9
TkA05G433010	`PF03435`	Sacchrp_dh_NADP	289	313	0.12	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV36`	Arabidopsis thaliana	sp\|Q9ZV36\|UXS6_ARATH UDP-glucuronic acid decarboxylase 6	86.100%	Swiss-Prot	High
`Q9FIE8`	Arabidopsis thaliana	sp\|Q9FIE8\|UXS3_ARATH UDP-glucuronic acid decarboxylase 3	86.100%	Swiss-Prot	High
`Q9SN95`	Arabidopsis thaliana	sp\|Q9SN95\|UXS5_ARATH UDP-glucuronic acid decarboxylase 5	87.900%	Swiss-Prot	High
`Q8S8T4`	Arabidopsis thaliana	sp\|Q8S8T4\|UXS4_ARATH UDP-glucuronic acid decarboxylase 4	72.700%	Swiss-Prot	High
`Q8VZC0`	Arabidopsis thaliana	sp\|Q8VZC0\|UXS1_ARATH UDP-glucuronic acid decarboxylase 1	72.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card