TkA05G430420 | RubberDandelionOmics

Gene overview

TkA05G430420

Reference: TK1151 Chr: Chr05 Coordinates: 107345445-107347205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1153 bp · TkA05G430420|TK1151|cDNA

AGCAGTAAATGCGGCCCTAAAAAAAGAAAAAAAGAAAAAAAGAAAAAACTGACGTTGGATAATCTCCCTCCACAACCATTTATCTACTCTTCCATAAATCATAAATCTAAACCCAACTAACAAACTCAGATTCTCAAATCCCAAATTACGTGAGCAACCAGTTCTTCAGCTGCCGGAATCTCTCAAAATTAGGGCTTTTACGGAGAGATGATCGGACCAGGGAGGCCGCAGATTGTATTATTCGGATCATCAATTGTTCA...

CDS

Download CDS FASTA

771 bp · TkA05G430420|TK1151|CDS

ATGATCGGACCAGGGAGGCCGCAGATTGTATTATTCGGATCATCAATTGTTCAGCTCAGCTTCAGCAATGATGGTTGGGGCGCCATTCTCGCCGACGTCTATGCTCGCAAGGCGGATATAGTATTGCGAGGATACTATGGCTGGAATTCCAGACGCGCTATCAAAGTTCTCGATCAAGTTTTTCCCAAGGATGCTGCAAATCACCCTTCACTGATCATTGTTTACTTTGGTGGTAATGATTCAATGGGACCCCACTCATC...

Protein

Download Protein FASTA

256 aa · TkA05G430420|TK1151|PROTEIN

MIGPGRPQIVLFGSSIVQLSFSNDGWGAILADVYARKADIVLRGYYGWNSRRAIKVLDQVFPKDAANHPSLIIVYFGGNDSMGPHSSGLGPHVPLPEYIENMRKIITHLKSLSDTTRLIFLSCPPVDEVKLSETASSFFSELVRTNELCRIYSEACVDLCNETGVKVIDLWTAFQKRDDWKTACFTDGVHLSGEGSKIVVEEIIKVLKESEWKPSLFWKNMPTEFSEDSPYDLVYSDGKTTLNPSDWTFHRDIQWD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G430420`
TK1151 ID	TkA05G430420
OH-1004 ID	LXL04_021861
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G430420

Location Chr05:107345445-107347205 (+)

Description Similar to CPRD49: GDSL esterase/lipase CPRD49

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11210`	GDSL esterase/lipase CPRD49.	No verified direct reference in this release
`At2g38180`	GDSL esterase/lipase At2g38180.	No verified direct reference in this release
`At5g62930`	GDSL esterase/lipase At5g62930.	No verified direct reference in this release
`At5g45920`	GDSL esterase/lipase At5g45920.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0708400`	Involved in the organization of leaf cuticle and wax crystals.	Mutation in Wilted Dwarf and Lethal 1 (WDL1) causes abnormal cuticle formation and rapid water loss in rice.2010 · DOI: 10.1007/s11103-010-9656-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021861 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G38180

ath:AT3G11210

ath:AT5G45920

ath:AT5G62930

dosa:Os11g0708400

osa:4351232

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.746

Rank 1 · TkA05G430420 · TK1151

Nucleus0.359

Rank 2 · TkA05G430420 · TK1151

Mitochondrion0.064

Rank 3 · TkA05G430420 · TK1151

Peroxisome0.054

Rank 4 · TkA05G430420 · TK1151

Cell membrane0.050

Rank 5 · TkA05G430420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL9-203 aa

PF13472Lipase_GDSL_211-197 aa

PF02836Glyco_hydro_2_C55-120 aa

PF04311DUF45965-205 aa

PF02836Glyco_hydro_2_C152-169 aa

PF19040SGNH162-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G430420	`PF00657`	Lipase_GDSL	9	203	8e-24	85.7
TkA05G430420	`PF13472`	Lipase_GDSL_2	11	197	1.1e-23	85.4
TkA05G430420	`PF02836`	Glyco_hydro_2_C	55	120	0.18	11.6
TkA05G430420	`PF04311`	DUF459	65	205	5e-05	23.5
TkA05G430420	`PF02836`	Glyco_hydro_2_C	152	169	0.18	11.6
TkA05G430420	`PF19040`	SGNH	162	204	0.027	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRM5`	Arabidopsis thaliana	sp\|Q9SRM5\|CPR49_ARATH GDSL esterase/lipase CPRD49	69.500%	Swiss-Prot	High
`O80443`	Arabidopsis thaliana	sp\|O80443\|GDL46_ARATH GDSL esterase/lipase At2g38180	59.500%	Swiss-Prot	High
`Q9FM04`	Arabidopsis thaliana	sp\|Q9FM04\|GDL88_ARATH GDSL esterase/lipase At5g62930	38.800%	Swiss-Prot	Medium
`Q6NMR9`	Arabidopsis thaliana	sp\|Q6NMR9\|GDL84_ARATH GDSL esterase/lipase At5g45920	44.000%	Swiss-Prot	Medium
`Q7XXR3`	Oryza sativa subsp. japonica	sp\|Q7XXR3\|WDL1_ORYSJ GDSL esterase/lipase WDL1	73.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card