TkA05G429580 | RubberDandelionOmics

Gene overview

TkA05G429580

Reference: TK1151 Chr: Chr05 Coordinates: 107173903-107175807 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

472 bp · TkA05G429580|TK1151|cDNA

GTCTAAGCAGGCCCATGTATTTGTATGATTTAGCTTGCCAGTTGAAATCCCCAAATATCATTTCAGACAACCCTAAAATTCTCAATCGGAAAAACAGGACAAGATATCGGAGATGACGACGACAACGACGACGACGATCAACGATACCACCAGTTCCGCTACTAAAACTCCTAAAAAGACCAATCTCTTAGATCATCACTCCATCAAGCACTTACTCGACGAAACTGTCACTGAGATCGTGACTAGTCGAGGTTACAGTG...

CDS

Download CDS FASTA

606 bp · TkA05G429580|TK1151|CDS

ATGACGACGACAACGACGACGACGATCAACGATACCACCAGTTCCGCTACTAAAACTCCTAAAAAGACCAATCTCTTAGATCATCACTCCATCAAGCACTTACTCGACGAAACTGTCACTGAGATCGTGACTAGTCGAGGTTACAGTGAAGATGTAAGGATGAGTAACGTCAGATTGTTGATCGGAGCGATCATCATCATCATTGCCCTCTTTGCTCAGTTTTACAATAAGAAGTTTCCGGATAACAAGAATTTCCTTAT...

Protein

Download Protein FASTA

201 aa · TkA05G429580|TK1151|PROTEIN

MTTTTTTTINDTTSSATKTPKKTNLLDHHSIKHLLDETVTEIVTSRGYSEDVRMSNVRLLIGAIIIIIALFAQFYNKKFPDNKNFLIGCIVSYVVFNGILQLIIYTKEKNAFLFTYPPAGSAYNSTGLMVSSKLPRFSDMYTLTIATADPKSISAKPTVEFTKSVTKWFTKDGVLVEGLFWKDVEGLVNDYAKGKENKKSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G429580`
TK1151 ID	TkA05G429580
OH-1004 ID	LXL04_011448
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.300
Protein coverage (%)	TK1151 40.796 / OH-1004 43.716 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G429580

Location Chr05:107173903-107175807 (+)

Description Similar to At2g39960: Probable signal peptidase complex subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39960`	Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011448 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0045047 protein targeting to ER Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005787 signal peptidase complex Cellular Component

KEGG gene cross-reference

ath:AT2G39960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.863

Rank 1 · TkA05G429580 · TK1151

Cytoplasm0.094

Rank 2 · TkA05G429580 · TK1151

Nucleus0.082

Rank 3 · TkA05G429580 · TK1151

Golgi apparatus0.046

Rank 4 · TkA05G429580 · TK1151

Mitochondrion0.045

Rank 5 · TkA05G429580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06703SPC2531-189 aa

PF01151ELO49-82 aa

PF20312DUF660853-107 aa

PF01151ELO84-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G429580	`PF06703`	SPC25	31	189	3.4e-42	144.6
TkA05G429580	`PF01151`	ELO	49	82	0.12	12.6
TkA05G429580	`PF20312`	DUF6608	53	107	0.059	14.2
TkA05G429580	`PF01151`	ELO	84	112	0.12	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P58684`	Arabidopsis thaliana	sp\|P58684\|SPCS2_ARATH Signal peptidase complex subunit 2	72.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card