TkA05G429470 | RubberDandelionOmics

Gene overview

TkA05G429470

Reference: TK1151 Chr: Chr05 Coordinates: 107113668-107115635 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1738 bp · TkA05G429470|TK1151|cDNA

CTCAAGCAGAATTAATATTTACACTTTAGTACACGATAAATATAAGCTCGCTGTTACACTCTTATATAAATTGCCTCCTCCCAAACCCCTGTATCTTCCCTGTGCAAGGAGAAAGACTGTGCAGAACCGTCGTCAGTCGTCGATCGTTGATTGTCGGTCGCCGGTCGTCCTCCTGAAAACGCACGCCGCACCTCTCTTCTTCCCAATCTTCAGTTTTACACACGCGCGGTTGGGTTTCGATTCGGTTCATCCTCTGTCTA...

CDS

Download CDS FASTA

939 bp · TkA05G429470|TK1151|CDS

ATGTCGGCAATTAAAAGCTCGTCGCCCAGCCGATTTTTCACGATCGGGCTTGTGACGTCGTGGTACTCATCCAACATTGGAGTTTTGTTGCTCAACAAGTACTTACTCAGCAATTACGGGTTCAAGTACCCGATCTTCCTCACTATGTGTCACATGACTGCTTGTGCTTTACTGAGCTACATCGCTATCGCATGGCTGAAGATGGTTCCGATGCAGACAATCCGATCTCGTGTTCAGTTCTTTAAGATCTCCGCTCTGAG...

Protein

Download Protein FASTA

312 aa · TkA05G429470|TK1151|PROTEIN

MSAIKSSSPSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACALLSYIAIAWLKMVPMQTIRSRVQFFKISALSLIFCGSVVSGNISLRYLPVSFNQAIGATTPFFTAVFAYLMTLKKEAWLTYITLIPVVTGVIIASGGEPSFHLFGFIMCIGATAARALKTVVQGILLSSEGEKLNSMNLLLYMAPIAVVLLLPATLYMEKNVVGITIALARQDFGIVWLLLFNSALAYFVNLTNFLVTKHTSAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G429470`
TK1151 ID	TkA05G429470
OH-1004 ID	LXL04_036232
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.200
Protein coverage (%)	TK1151 97.756 / OH-1004 95.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G429470

Location Chr05:107113668-107115635 (-)

Description Similar to UUAT1: UDP-URONIC ACID TRANSPORTER 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05820`	Probable sugar phosphate/phosphate translocator At5g05820.	No verified direct reference in this release
`At3g11320`	Probable sugar phosphate/phosphate translocator At3g11320.	No verified direct reference in this release
`At5g04160`	UDP-glucuronic acid transporter that modulates the polysaccharide composition of seed mucilage.	UUAT1 Is a Golgi-Localized UDP-Uronic Acid Transporter That Modulates the Polysaccharide Composition of Arabidopsis Seed Mucilage.2017 · DOI: 10.1105/tpc.16.00465
`At3g10290`	Probable sugar phosphate/phosphate translocator At3g10290.	No verified direct reference in this release
`At1g12500`	Probable sugar phosphate/phosphate translocator At1g12500.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12500

ath:AT3G10290

ath:AT3G11320

ath:AT5G04160

ath:AT5G05820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.637

Rank 1 · TkA05G429470 · TK1151

Endoplasmic reticulum0.209

Rank 2 · TkA05G429470 · TK1151

Cytoplasm0.095

Rank 3 · TkA05G429470 · TK1151

Lysosome / Vacuole0.057

Rank 4 · TkA05G429470 · TK1151

Cell membrane0.045

Rank 5 · TkA05G429470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA2-33 aa

PF03151TPT17-304 aa

PF08449UAA31-306 aa

PF00892EamA43-151 aa

PF29234DUF851962-62 aa

PF29234DUF8519124-150 aa

PF29234DUF8519157-211 aa

PF00892EamA160-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G429470	`PF00892`	EamA	2	33	5.4e-09	37.1
TkA05G429470	`PF03151`	TPT	17	304	8.2e-45	154.1
TkA05G429470	`PF08449`	UAA	31	306	2.4e-12	47.4
TkA05G429470	`PF00892`	EamA	43	151	5.4e-09	37.1
TkA05G429470	`PF29234`	DUF8519	62	62	0.028	15.6
TkA05G429470	`PF29234`	DUF8519	124	150	0.028	15.6
TkA05G429470	`PF29234`	DUF8519	157	211	0.028	15.6
TkA05G429470	`PF00892`	EamA	160	303	5.4e-09	37.1
TkA05G429470	`PF29234`	DUF8519	276	289	0.028	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DBP3`	Arabidopsis thaliana	sp\|Q6DBP3\|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820	89.300%	Swiss-Prot	High
`Q5XF09`	Arabidopsis thaliana	sp\|Q5XF09\|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320	90.700%	Swiss-Prot	High
`Q9FYE5`	Arabidopsis thaliana	sp\|Q9FYE5\|UUAT1_ARATH UDP-URONIC ACID TRANSPORTER 1	72.400%	Swiss-Prot	High
`Q9SS40`	Arabidopsis thaliana	sp\|Q9SS40\|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290	70.700%	Swiss-Prot	High
`Q9LDH3`	Arabidopsis thaliana	sp\|Q9LDH3\|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card