TkA05G429130 | RubberDandelionOmics

Gene overview

TkA05G429130

Reference: TK1151 Chr: Chr05 Coordinates: 107053388-107054038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA05G429130|TK1151|cDNA

ATGGAATTAGAGAGCTTATTAACTCAGCAGAAGCATAGACAACAAATGATTGATGATTTGTCGGCCAATCTTTACAACAACAGATTTGGGGAGTTGAAGGGTACGAATCTCGATGATGTTTTTGGATCTTTTGATTTGCAATCTCCAACTGGACACCAACAAATCCGGCAGAACGTTAACCAGCTCCGAGGAAACTACAAGTCTTCTCCGATTAGAAAACCGGCGGGTTTTGCTTTTGATTCATCGGCGGCGGTTGCTCA...

CDS

Download CDS FASTA

651 bp · TkA05G429130|TK1151|CDS

ATGGAATTAGAGAGCTTATTAACTCAGCAGAAGCATAGACAACAAATGATTGATGATTTGTCGGCCAATCTTTACAACAACAGATTTGGGGAGTTGAAGGGTACGAATCTCGATGATGTTTTTGGATCTTTTGATTTGCAATCTCCAACTGGACACCAACAAATCCGGCAGAACGTTAACCAGCTCCGAGGAAACTACAAGTCTTCTCCGATTAGAAAACCGGCGGGTTTTGCTTTTGATTCATCGGCGGCGGTTGCTCA...

Protein

Download Protein FASTA

216 aa · TkA05G429130|TK1151|PROTEIN

MELESLLTQQKHRQQMIDDLSANLYNNRFGELKGTNLDDVFGSFDLQSPTGHQQIRQNVNQLRGNYKSSPIRKPAGFAFDSSAAVAQAVINSRSGAFSKQRSQSFIDRGTGGPGSGAMSPRFSQWGSPEGKLEWGFNGEDANKFRKSASFGFRNGVPVNEPDVSWVNTMVKDVSSVGVGLYSSSEKQRYGGGGGGGGDKLPPWVEQMIREQERLVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G429130`
TK1151 ID	TkA05G429130
OH-1004 ID	LXL04_021847
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 36.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G429130

Location Chr05:107053388-107054038 (-)

Description Similar to At2g40140: Zinc finger CCCH domain-containing protein 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40140`	Involved in salt stress response.	No verified direct reference in this release
`At3g55980`	Involved in salt stress response.	No verified direct reference in this release
`At5g58620`	Zinc finger CCCH domain-containing protein 66.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0128200`	Zinc finger CCCH domain-containing protein 33.	No verified direct reference in this release
`Os03g0698800`	Zinc finger CCCH domain-containing protein 24.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080090 regulation of primary metabolic process Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G40140

ath:AT3G55980

ath:AT5G12850

ath:AT5G58620

dosa:Os03g0698800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.524

Rank 1 · TkA05G429130 · TK1151

Nucleus0.445

Rank 2 · TkA05G429130 · TK1151

Cell membrane0.112

Rank 3 · TkA05G429130 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA05G429130 · TK1151

Golgi apparatus0.042

Rank 5 · TkA05G429130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12209SAC38-26 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G429130	`PF12209`	SAC3	8	26	0.13	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XEE6`	Arabidopsis thaliana	sp\|Q9XEE6\|C3H29_ARATH Zinc finger CCCH domain-containing protein 29	38.600%	Swiss-Prot	Medium
`Q93ZS9`	Arabidopsis thaliana	sp\|Q93ZS9\|C3H47_ARATH Zinc finger CCCH domain-containing protein 47	41.900%	Swiss-Prot	Medium
`Q9LUZ4`	Arabidopsis thaliana	sp\|Q9LUZ4\|C3H66_ARATH Zinc finger CCCH domain-containing protein 66	35.500%	Swiss-Prot	Medium
`Q688R3`	Oryza sativa subsp. japonica	sp\|Q688R3\|C3H33_ORYSJ Zinc finger CCCH domain-containing protein 33	47.200%	Swiss-Prot	Medium
`Q10EL1`	Oryza sativa subsp. japonica	sp\|Q10EL1\|C3H24_ORYSJ Zinc finger CCCH domain-containing protein 24	49.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card