TkA05G421010 | RubberDandelionOmics

Gene overview

TkA05G421010

Reference: TK1151 Chr: Chr05 Coordinates: 104894085-104896299 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1450 bp · TkA05G421010|TK1151|cDNA

GATTTTAGCCTAGGTATCAATAACAATACAGGATATATTAATGTTAGATATAATCAAGGTAAACAAAAAAAGCTATTTCAATCATCAACCATTTCTACAATTTACTCTGTGACTACATCCAAAAAAATGGAAGCTTTGGTATGCAGAAACCTCGGCGACCCAACAACGCCACCGGATTCATCGGAAACCACCGCTCTCACTGTCTCTACATCTCACCCTATCCCCAAACTCACTTCTCCAACTTCAATCAGAGTTCGAAT...

CDS

Download CDS FASTA

1173 bp · TkA05G421010|TK1151|CDS

GATTTTAGCCTAGGTATCAATAACAATACAGGATATATTAATGTTAGATATAATCAAGGTAAACAAAAAAAGCTATTTCAATCATCAACCATTTCTACAATTTACTCTGTGACTACATCCAAAAAAATGGAAGCTTTGGTATGCAGAAACCTCGGCGACCCAACAACGCCACCGGATTCATCGGAAACCACCGCTCTCACTGTCTCTACATCTCACCCTATCCCCAAACTCACTTCTCCAACTTCAATCAGAGTTCGAAT...

Protein

Download Protein FASTA

390 aa · TkA05G421010|TK1151|PROTEIN

DFSLGINNNTGYINVRYNQGKQKKLFQSSTISTIYSVTTSKKMEALVCRNLGDPTTPPDSSETTALTVSTSHPIPKLTSPTSIRVRIKSTSLNYANYLQVLGKYQEKFALPFVPGSDYAGIVESVGPKVTKFKVGDPVCSVAGVGSFAQFIVAEEKDLFGVPDGCDLVAAGALPVAYGTSHVALVHRANLKAGQVLLVLGAAGGVGLAAVQIGKVCGAIVVAVARGNEKVEFLKSMGVDHVVDLSKGGVIESVKSFLKSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G421010`
TK1151 ID	TkA05G421010
OH-1004 ID	LXL04_011191
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 36.410 / OH-1004 50.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G421010`
Location	Chr05:104894085-104896299 (+)
Description	Similar to Quinone oxidoreductase-like protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011191` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0033068 macrolide biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0004312 fatty acid synthase activity Molecular Function GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0031177 phosphopantetheine binding Molecular Function GO:0047879 erythronolide synthase activity Molecular Function
KEGG gene cross-reference	mmu:226527 nve:5520320 rno:289138 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.429

Rank 1 · TkA05G421010 · TK1151

Plastid0.304

Rank 2 · TkA05G421010 · TK1151

Peroxisome0.176

Rank 3 · TkA05G421010 · TK1151

Cytoplasm0.077

Rank 4 · TkA05G421010 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA05G421010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N80-163 aa

PF01262AlaDh_PNT_C168-267 aa

PF13602ADH_zinc_N_2177-220 aa

PF01327Pep_deformylase200-229 aa

PF00107ADH_zinc_N204-324 aa

PF13602ADH_zinc_N_2236-377 aa

PF17540DUF5457317-373 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G421010	`PF08240`	ADH_N	80	163	5.1e-15	56.3
TkA05G421010	`PF01262`	AlaDh_PNT_C	168	267	0.13	12.3
TkA05G421010	`PF13602`	ADH_zinc_N_2	177	220	2.7e-16	61.4
TkA05G421010	`PF01327`	Pep_deformylase	200	229	0.093	13.0
TkA05G421010	`PF00107`	ADH_zinc_N	204	324	1.6e-23	83.8
TkA05G421010	`PF13602`	ADH_zinc_N_2	236	377	2.7e-16	61.4
TkA05G421010	`PF17540`	DUF5457	317	373	0.061	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card