TkA05G419750 | RubberDandelionOmics

Gene overview

TkA05G419750

Reference: TK1151 Chr: Chr05 Coordinates: 104544461-104546139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1199 bp · TkA05G419750|TK1151|cDNA

TTTTGTTGGGAAATTATTGGTTTATATTTGAAAGTTTAGAGTGAGACGGAAGACTTCCTGGACTTCTTCCCTGCGTCGCAGGGTCGGCTGAATATTCTCCAAATCGATCAGCTCCCAAGTCCCAAATCTACCATCGCCGCCTGCGCCGACCGGCCTCCCGCCCCGGCGTCCTGGTATCTCTGTAAGCAGGCAGCAGCCACCAGTGGCCTCTCGAGTCTCGCCCATCACTCCAGCAGTCGACGACTTCCGCCGCCTCCTGC...

CDS

Download CDS FASTA

579 bp · TkA05G419750|TK1151|CDS

ATGGCTTCGGTTCAAGAAGACGACGACTCCTCAAATCACCACAACTCCCCCAAAAAAGTATACAAAGATCCAGATGATGGCCGACAAAGATTCTTACTTGAACTGGAATTCATACAATGCCTTGCCAATCCAACTTACATTCACTATTTGGCTCAAAACCGTTATTTTGAAGATGAAGCTTTCATTGGCTACCTAAAGTACCTTCAATACTGGCAACGACCAGAATATATAAAATACATCATGTATCCACATTGTCTCTA...

Protein

Download Protein FASTA

192 aa · TkA05G419750|TK1151|PROTEIN

MASVQEDDDSSNHHNSPKKVYKDPDDGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKYIMYPHCLYFLELLQNASFRNAMAHPANKELTHRQQFYFWKNYRNNRLKHILPRPLPETTAPPPAPPPPTATIAAASSGQVAVPPVLSPMQYGGPPGPPMKSDPRGGIDRRKRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G419750`
TK1151 ID	TkA05G419750
OH-1004 ID	LXL04_021766
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G419750

Location Chr05:104544461-104546139 (-)

Description Similar to MED31: Mediator of RNA polymerase II transcription subunit 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19910`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021766 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008595 anterior/posterior axis specification, embryo Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048147 negative regulation of fibroblast proliferation Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G19910

bta:532868

ddi:DDB_G0285221

dme:Dmel_CG1057

mmu:67279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.574

Rank 1 · TkA05G419750 · TK1151

Cytoplasm0.452

Rank 2 · TkA05G419750 · TK1151

Cell membrane0.073

Rank 3 · TkA05G419750 · TK1151

Mitochondrion0.051

Rank 4 · TkA05G419750 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA05G419750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05669Med3129-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G419750	`PF05669`	Med31	29	121	1.3e-35	122.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYB1`	Arabidopsis thaliana	sp\|Q8VYB1\|MED31_ARATH Mediator of RNA polymerase II transcription subunit 31	72.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card