TkA05G418350 | RubberDandelionOmics

Gene overview

TkA05G418350

Reference: TK1151 Chr: Chr05 Coordinates: 104162014-104166814 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1240 bp · TkA05G418350|TK1151|cDNA

CAAACACACAAAATCAATGGCTACCAATTCTTCACATTTCCTCTTCTTATTATATCTTCTCACTTTTTTCACATTTGCATTTGCCATAAGACCAAAACACTTCAACATATCAACCGTCGCCACCCACTGGGCCTCTGCCACCGCCACTTGGTATGGCAGTCCCGATGGTGCAGGAAGTGATGGAGGTTCATGTGGGTATGGAACGGCAGTGTCAAAAGCACCATTTTCTTCCATGGTGACTGGAATTGGTCCATCTCTTT...

CDS

Download CDS FASTA

804 bp · TkA05G418350|TK1151|CDS

ATGGCTACCAATTCTTCACATTTCCTCTTCTTATTATATCTTCTCACTTTTTTCACATTTGCATTTGCCATAAGACCAAAACACTTCAACATATCAACCGTCGCCACCCACTGGGCCTCTGCCACCGCCACTTGGTATGGCAGTCCCGATGGTGCAGGAAGTGATGGAGGTTCATGTGGGTATGGAACGGCAGTGTCAAAAGCACCATTTTCTTCCATGGTGACTGGAATTGGTCCATCTCTTTACAATGGAGGGAAAGA...

Protein

Download Protein FASTA

267 aa · TkA05G418350|TK1151|PROTEIN

MATNSSHFLFLLYLLTFFTFAFAIRPKHFNISTVATHWASATATWYGSPDGAGSDGGSCGYGTAVSKAPFSSMVTGIGPSLYNGGKECGACYEVKCTKHPACSHKPARVVITDFCPGGKCAAGHGHFDLSGTAFGAMAKPGQEKHLRDAGDLQIRFARVECDYSRSNIVFHVDQGSNPNYFAVVVEFEEGDGDLGGVSLKEENSTKWLKMVQSWGAVWKVDPGRELHPPFSIRLISQYSKRVLVAKDVIPSGWKPGSIYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G418350`
TK1151 ID	TkA05G418350
OH-1004 ID	LXL04_021745
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G418350

Location Chr05:104162014-104166814 (-)

Description Similar to EXPB2: Putative expansin-B2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65680`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0658800`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os04g0552000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os05g0246300`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os02g0658600`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65680

dosa:Os02g0658600

dosa:Os02g0658800

dosa:Os04g0552000

dosa:Os05g0246300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.426

Rank 1 · TkA05G418350 · TK1151

Lysosome / Vacuole0.212

Rank 2 · TkA05G418350 · TK1151

Cytoplasm0.110

Rank 3 · TkA05G418350 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA05G418350 · TK1151

Cell membrane0.087

Rank 5 · TkA05G418350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515Expansin_N10-141 aa

PF07853DUF164833-48 aa

PF03330DPBB_141-59 aa

PF22514EXPB1_D141-161 aa

PF03330DPBB_179-142 aa

PF07853DUF1648126-139 aa

PF01357Expansin_C168-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G418350	`PF29515`	Expansin_N	10	141	8.7e-12	46.0
TkA05G418350	`PF07853`	DUF1648	33	48	7.3	7.1
TkA05G418350	`PF03330`	DPBB_1	41	59	4.3e-17	62.8
TkA05G418350	`PF22514`	EXPB1_D1	41	161	1.6e-05	26.0
TkA05G418350	`PF03330`	DPBB_1	79	142	4.3e-17	62.8
TkA05G418350	`PF07853`	DUF1648	126	139	7.3	7.1
TkA05G418350	`PF01357`	Expansin_C	168	250	3.1e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHY6`	Arabidopsis thaliana	sp\|Q9SHY6\|EXPB2_ARATH Putative expansin-B2	54.900%	Swiss-Prot	High
`Q6H676`	Oryza sativa subsp. japonica	sp\|Q6H676\|EXB11_ORYSJ Expansin-B11	60.900%	Swiss-Prot	High
`Q7XT40`	Oryza sativa subsp. japonica	sp\|Q7XT40\|EXB15_ORYSJ Expansin-B15	58.100%	Swiss-Prot	High
`Q5W6Z9`	Oryza sativa subsp. japonica	sp\|Q5W6Z9\|EXB18_ORYSJ Expansin-B18	53.400%	Swiss-Prot	High
`Q6H677`	Oryza sativa subsp. japonica	sp\|Q6H677\|EXB14_ORYSJ Putative expansin-B14	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card