TkA05G417830 | RubberDandelionOmics

Gene overview

TkA05G417830

Reference: TK1151 Chr: Chr05 Coordinates: 104030374-104034660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1664 bp · TkA05G417830|TK1151|cDNA

AAAAAAAAAAAAAAGAAAGTCTGAATATACAAGTGGTTGCTAATTTGCTCACGATCTCTCTCCATCATTCATTCGCTTCGAAAGTGAGGTGCTTCTTGGACGATTTCGATGTTCTAGATGAAATCATCTCTATGCTCTTGAGAGTGAAAGAAGATATTCAAATCACGATCCTCTGATCACTTTCTTTCGATCGATATCAATTCTCAGCTACCTGCAACTCCGGCGAGCTTAAAACCAGAAGATGAAGAAGGACAAATCAG...

CDS

Download CDS FASTA

1251 bp · TkA05G417830|TK1151|CDS

ATGAAGAAGGACAAATCAGTGTTAATAGCAAGCCCTAGCAGAACTACGCGAACGAAATCATCTTCTTCAAACAGAGTATACGTTCCTGAAGAAGAAGAAGAAGAATCGGAGAAGCGACAAATTAGTAATGACTTCCCTTTTCCCATGGCCACTCGTAATGGTTCATCCAAATACGATTTCGTCAAGGTGAAAGTATGGCTGGGAGATAATGCCGATCACTACTATGTCCTCTCTAGATTTTTGCTTAGTAGAATGTTGAC...

Protein

Download Protein FASTA

416 aa · TkA05G417830|TK1151|PROTEIN

MKKDKSVLIASPSRTTRTKSSSSNRVYVPEEEEEESEKRQISNDFPFPMATRNGSSKYDFVKVKVWLGDNADHYYVLSRFLLSRMLTVTKIPNHVALKIALELKKLLIDNSLLDVSQSDLEANLFKLMERRGYGQEYINRYKMMTRFHHQRVPLVILVCGTACVGKSTIATQLGQRLNLPNVLQTDMVYELLRTSTDAPLTSSPIWARDFASSEELITEFCRECRIVRKGLAGDLKKAMKDGKPIIIEGMHVDPSIYLMD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G417830`
TK1151 ID	TkA05G417830
OH-1004 ID	LXL04_021738
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G417830`
Location	Chr05:104030374-104034660 (-)
Description	Similar to pgk2: 2-phosphoglycerate kinase (Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021738` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005524 ATP binding Molecular Function GO:0016301 kinase activity Molecular Function GO:0016774 phosphotransferase activity, carboxyl group as acceptor Molecular Function
KEGG gene cross-reference	mja:MJ_1482 mka:MK0868 pab:PAB2253 pfu:PF0078 pho:PH0149 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · TkA05G417830 · TK1151

Nucleus0.396

Rank 2 · TkA05G417830 · TK1151

Cell membrane0.122

Rank 3 · TkA05G417830 · TK1151

Golgi apparatus0.079

Rank 4 · TkA05G417830 · TK1151

Lysosome / Vacuole0.069

Rank 5 · TkA05G417830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25199nSTAND_NTPase5146-178 aa

PF08433KTI12153-179 aa

PF13671AAA_33155-209 aa

PF13238AAA_18156-254 aa

PF13521AAA_28156-194 aa

PF02224Cytidylate_kin158-191 aa

PF02224Cytidylate_kin225-250 aa

PF13238AAA_18278-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G417830	`PF25199`	nSTAND_NTPase5	146	178	0.15	12.6
TkA05G417830	`PF08433`	KTI12	153	179	0.051	13.8
TkA05G417830	`PF13671`	AAA_33	155	209	0.00021	22.3
TkA05G417830	`PF13238`	AAA_18	156	254	1.2e-07	33.0
TkA05G417830	`PF13521`	AAA_28	156	194	0.12	13.3
TkA05G417830	`PF02224`	Cytidylate_kin	158	191	0.14	12.6
TkA05G417830	`PF02224`	Cytidylate_kin	225	250	0.14	12.6
TkA05G417830	`PF13238`	AAA_18	278	329	1.2e-07	33.0
TkA05G417830	`PF16932`	T4SS_TraI	288	378	0.0056	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card