TkA05G417320 | RubberDandelionOmics

Gene overview

TkA05G417320

Reference: TK1151 Chr: Chr05 Coordinates: 103875463-103880539 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2364 bp · TkA05G417320|TK1151|cDNA

GTTAGTTTAATTATCGTATCTTCGGCCCGGTTTGTATTCGGTCCTTCCATAATAAGAAGCCGCTCGTCTCAGGTTACCACGGCGGCGCTACCGCCGCTAACAGACGCCTATGATGACCTCGCTAATCCGTAGAGCGGCGTCAAGCCTAAGCTCCAACTCCAAAAGCCGTCACTTTTTTGCACCTGCAACGCATCGCATGGAGGAGACTGGTTTATATGGATGCAATCATCTGAAGACCCCCAAAGGTTTCCAGCGTTTTG...

CDS

Download CDS FASTA

1470 bp · TkA05G417320|TK1151|CDS

ATGAAGCCCATTAATCGGTCAACTTCACAAAGTCAAAAAGTCAACACCAGAGAAAAAGGGTTCCGAATAGTAACAGAACCAAGCACTGTTTCATCTGTTTTACAATGGGCACATGATGATGAGGTTAGGAAAATGACATATATAAAAAGCAATTCTGTACCACGTGCAAATCTTGGCGTTCTTGATAACCTAATTTCTGCACGACATGAAATTTCTGAGATAATGGGGTATAAATCATATGCTCACTATGCTTTGAATTC...

Protein

Download Protein FASTA

489 aa · TkA05G417320|TK1151|PROTEIN

MKPINRSTSQSQKVNTREKGFRIVTEPSTVSSVLQWAHDDEVRKMTYIKSNSVPRANLGVLDNLISARHEISEIMGYKSYAHYALNSNMASSPDVVSSFLVDLSKTVHPKALEEFESICNYKKEKTGQQGLEPWDEAYFTRSMKSSTYNFDFSVVASYFSLTQCIEGLKVIVESLFGMKFLNYPLAPGESWHPDVMKMALHHPDEGDLGYIYLDLNSRHGKYPGCAHFAIRGGRRVSKTEYQLPVIALVCNFSKPHNSSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G417320`
TK1151 ID	TkA05G417320
OH-1004 ID	LXL04_021717
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 69.362 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G417320

Location Chr05:103875463-103880539 (-)

Description Similar to OCT1: Mitochondrial intermediate peptidase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51540`	Aminopeptidase which cleaves preproteins, imported into the mitochondrion, to their mature size.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006518 peptide metabolic process Biological Process

GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process

GO:0016485 protein processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004177 aminopeptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G51540

hsa:4285

mmu:70478

pon:100171586

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · TkA05G417320 · TK1151

Nucleus0.232

Rank 2 · TkA05G417320 · TK1151

Peroxisome0.216

Rank 3 · TkA05G417320 · TK1151

Mitochondrion0.135

Rank 4 · TkA05G417320 · TK1151

Plastid0.051

Rank 5 · TkA05G417320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01432Peptidase_M335-462 aa

PF13398Peptidase_M50B266-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G417320	`PF01432`	Peptidase_M3	35	462	3.5e-112	376.8
TkA05G417320	`PF13398`	Peptidase_M50B	266	287	0.14	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KDA5`	Arabidopsis thaliana	sp\|F4KDA5\|MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial	65.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card