TkA05G416720 | RubberDandelionOmics

Gene overview

TkA05G416720

Reference: TK1151 Chr: Chr05 Coordinates: 103724183-103729086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2366 bp · TkA05G416720|TK1151|cDNA

CTTGGATAATGTACTTTAGGCCCATATTGGACTTTTGGTTCCTCACGGTTTCCGGCTCCGAAGTTTGTTACTTTCGTACCCTTCTTCATAATTCCATCTCTCTCTCTCTTGATCGATCGGTACTTTCATTGCCGTCAAGAACTTCAAGAACCCTAACCCTTTGTCCTCTCAAACAACCAATTGCAGTTAGCTCATATACAAATACTAATCCACGAATCACACATGCCTCCTCGGAAGACGCCTGCAAAGCGCAAGAAGCC...

CDS

Download CDS FASTA

882 bp · TkA05G416720|TK1151|CDS

ATGATCGTAAATCACCGAAACAAGAAGTTGGAAACGGTAGCTGAATTGCCGAATGTTTCGAAAGTCGAGACGGAGGAGATATCGGGTCAGGTAGAAGTATCCGATCCTATTTTAGCTAAAATCGACGGGGATTCAACTACAGCTGTTGCGTTTTCTCCCAAAATGGTGATTGAGGCGGATGTAGTTGTGGAGAATTCTGCAGTTGGTGATGTGAATGAAGCGAGAAATGAGGATGTTTGCGTAGAAGATGAAGAACCTGA...

Protein

Download Protein FASTA

293 aa · TkA05G416720|TK1151|PROTEIN

MIVNHRNKKLETVAELPNVSKVETEEISGQVEVSDPILAKIDGDSTTAVAFSPKMVIEADVVVENSAVGDVNEARNEDVCVEDEEPEEDEEPEEDEQPSGIDGSQLETVAAEEPNADKAPCNNDATTKTSSEDYIALLIEHDNEESDNGSEVRGKILKISQSQDNHTLYLGNISKTWNKRKVNQQLKQYGIEHIDMIRLPENPKIEGKNKGFAFLEFNSHSDAVTAYQRLKKPDAVFGRDISAKVAFAQTPVLQNDDEDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G416720`
TK1151 ID	TkA05G416720
OH-1004 ID	LXL04_021710
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	67.900
Protein coverage (%)	TK1151 86.689 / OH-1004 42.705 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G416720`
Location	Chr05:103724183-103729086 (+)
Description	Similar to LIF2: Heterogeneous nuclear ribonucleoprotein Q
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021710` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0009617 response to bacterium Biological Process GO:0009909 regulation of flower development Biological Process GO:0010439 regulation of glucosinolate biosynthetic process Biological Process GO:0010468 regulation of gene expression Biological Process GO:0016554 cytidine to uridine editing Biological Process GO:0032733 positive regulation of interleukin-10 production Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0042742 defense response to bacterium Biological Process
KEGG gene cross-reference	ath:AT4G00830 cfa:403423 dre:562991 hsa:54502 pon:100174683 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.822

Rank 1 · TkA05G416720 · TK1151

Cytoplasm0.221

Rank 2 · TkA05G416720 · TK1151

Cell membrane0.029

Rank 3 · TkA05G416720 · TK1151

Mitochondrion0.027

Rank 4 · TkA05G416720 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA05G416720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04926PAP_RNA-bind77-209 aa

PF00076RRM_1168-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G416720	`PF04926`	PAP_RNA-bind	77	209	0.12	12.8
TkA05G416720	`PF00076`	RRM_1	168	239	9.3e-08	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card