TkA05G416400 | RubberDandelionOmics

Gene overview

TkA05G416400

Reference: TK1151 Chr: Chr05 Coordinates: 103626564-103627328 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · TkA05G416400|TK1151|cDNA

ATGGTGCCGATGTCAACGTCGCAGAAACAAATGACGGTGGCGCCGCCGCGGAGGTGCTCAAAGGATCGTCATACAAAGGTGGAGGGACGCGGTCGGAGAATCCGCATGCCGGCTGCTTGTGCTGCGAGGATCTTTCAGTTAACTCGGGAACTCGGGCACAAATCAGACGGAGAGACGATTCGATGGTTGTTGGAGCACGCAGAGCCGGCTATCGTAAAAGCTACCGGCACCGGGACGGTGCCGGCGCTGGCTGTGAATGT...

CDS

Download CDS FASTA

765 bp · TkA05G416400|TK1151|CDS

ATGGTGCCGATGTCAACGTCGCAGAAACAAATGACGGTGGCGCCGCCGCGGAGGTGCTCAAAGGATCGTCATACAAAGGTGGAGGGACGCGGTCGGAGAATCCGCATGCCGGCTGCTTGTGCTGCGAGGATCTTTCAGTTAACTCGGGAACTCGGGCACAAATCAGACGGAGAGACGATTCGATGGTTGTTGGAGCACGCAGAGCCGGCTATCGTAAAAGCTACCGGCACCGGGACGGTGCCGGCGCTGGCTGTGAATGT...

Protein

Download Protein FASTA

254 aa · TkA05G416400|TK1151|PROTEIN

MVPMSTSQKQMTVAPPRRCSKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIRWLLEHAEPAIVKATGTGTVPALAVNVNGTLKIPTTPMEEAGDVKRRKRGCNSEFYDLNDAATSNFAPVAPIAPRAIVPLWTMCAPPTAGVHGEAFLMIPPCGPTGATAFHQSQLWAIPTGVTPVFNVPTRPMASYLPAMKPVVGIGGGEVQTPAVSSSSISTTVVRDLSLDVGDKRELQFMEGCSKDRIPPSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G416400`
TK1151 ID	TkA05G416400
OH-1004 ID	LXL04_035305
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 99.606 / OH-1004 72.569 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G416400

Location Chr05:103626564-103627328 (+)

Description Similar to TCP19: Transcription factor TCP19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51910`	Transcription factor TCP19.	No verified direct reference in this release
`At2g45680`	Transcription factor TCP9.	No verified direct reference in this release
`At3g27010`	Transcription factor that binds to the site II motif (3'- TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes.	Internal telomeric repeats and 'TCP domain' protein-binding sites co-operate to regulate gene expression in Arabidopsis thaliana cycling cells.2003 · DOI: 10.1046/j.1365-313x.2003.01682.x Arabidopsis TCP20 links regulation of growth and cell division control pathways.2005 · DOI: 10.1073/pnas.0504039102

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YXQ1`	Transcription activator.	No verified direct reference in this release
`Os08g0544800`	Transcription activator.	DNA binding and dimerization specificity and potential targets for the TCP protein family.2002 · DOI: 10.1046/j.1365-313x.2002.01294.x PCF1 and PCF2 specifically bind to cis elements in the rice proliferating cell nuclear antigen gene.1997 · DOI: 10.1105/tpc.9.9.1607

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035305 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009624 response to nematode Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010229 inflorescence development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G69690

ath:AT2G45680

ath:AT5G51910

dosa:Os08g0544800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.949

Rank 1 · TkA05G416400 · TK1151

Cytoplasm0.137

Rank 2 · TkA05G416400 · TK1151

Cell membrane0.018

Rank 3 · TkA05G416400 · TK1151

Mitochondrion0.017

Rank 4 · TkA05G416400 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA05G416400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634TCP20-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G416400	`PF03634`	TCP	20	86	5.5e-25	89.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT89`	Arabidopsis thaliana	sp\|Q9LT89\|TCP19_ARATH Transcription factor TCP19	50.000%	Swiss-Prot	High
`O64647`	Arabidopsis thaliana	sp\|O64647\|TCP9_ARATH Transcription factor TCP9	46.600%	Swiss-Prot	Medium
`Q9LSD5`	Arabidopsis thaliana	sp\|Q9LSD5\|TCP20_ARATH Transcription factor TCP20	72.300%	Swiss-Prot	Low
`A2YXQ1`	Oryza sativa subsp. indica	sp\|A2YXQ1\|PCF2_ORYSI Transcription factor PCF2	47.900%	Swiss-Prot	Medium
`Q6ZBH6`	Oryza sativa subsp. japonica	sp\|Q6ZBH6\|PCF2_ORYSJ Transcription factor PCF2	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card