TkA05G412800 | RubberDandelionOmics

Gene overview

TkA05G412800

Reference: TK1151 Chr: Chr05 Coordinates: 102720275-102720685 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA05G412800|TK1151|cDNA

ATGAACCCTAGACTCGGATCCTTTGCGTTTGCTGAATTCTTAACAAGAAACGAAAACGGACATCATGTAGTTGTCGACAAGAAAATTTGTGTTCGTGGGATTTTTGGGTATATGGCACCAGAATATATGGAGGTGGGGGAAGCTACAACAATGGCGGATATCTACAGTTTCGGCGTGGTGCTGCTGGAGTTGGTGAGTGGGCAGAAGGCGGTGGATTTCAGACGGCCTGAGGTGCTATTAGTGAAACAAGTTCATGAATC...

CDS

Download CDS FASTA

411 bp · TkA05G412800|TK1151|CDS

ATGAACCCTAGACTCGGATCCTTTGCGTTTGCTGAATTCTTAACAAGAAACGAAAACGGACATCATGTAGTTGTCGACAAGAAAATTTGTGTTCGTGGGATTTTTGGGTATATGGCACCAGAATATATGGAGGTGGGGGAAGCTACAACAATGGCGGATATCTACAGTTTCGGCGTGGTGCTGCTGGAGTTGGTGAGTGGGCAGAAGGCGGTGGATTTCAGACGGCCTGAGGTGCTATTAGTGAAACAAGTTCATGAATC...

Protein

Download Protein FASTA

136 aa · TkA05G412800|TK1151|PROTEIN

MNPRLGSFAFAEFLTRNENGHHVVVDKKICVRGIFGYMAPEYMEVGEATTMADIYSFGVVLLELVSGQKAVDFRRPEVLLVKQVHESEGYEGNYEELVDPMLDGEYNRKELVRLVKLAMACTQSNPELRPNYEDGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G412800`
TK1151 ID	TkA05G412800
OH-1004 ID	LXL04_014558
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 95.588 / OH-1004 15.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G412800

Location Chr05:102720275-102720685 (+)

Description Similar to LECRKS2: Receptor like protein kinase S.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32800`	Receptor like protein kinase S.2.	No verified direct reference in this release
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release
`At5g10290`	Probable LRR receptor-like serine/threonine-protein kinase At5g10290.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014558 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32800

ath:AT3G53810

ath:AT5G59260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA05G412800 · TK1151

Cell membrane0.375

Rank 2 · TkA05G412800 · TK1151

Nucleus0.244

Rank 3 · TkA05G412800 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA05G412800 · TK1151

Golgi apparatus0.039

Rank 5 · TkA05G412800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase7-132 aa

PF07714PK_Tyr_Ser-Thr35-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G412800	`PF00069`	Pkinase	7	132	4.4e-07	30.3
TkA05G412800	`PF07714`	PK_Tyr_Ser-Thr	35	133	6.2e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48837`	Arabidopsis thaliana	sp\|O48837\|LRKS2_ARATH Receptor like protein kinase S.2	54.500%	Swiss-Prot	High
`Q93ZS4`	Arabidopsis thaliana	sp\|Q93ZS4\|CIK1_ARATH Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	37.500%	Swiss-Prot	Medium
`Q9ASQ6`	Arabidopsis thaliana	sp\|Q9ASQ6\|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720	37.700%	Swiss-Prot	Medium
`C0LGT1`	Arabidopsis thaliana	sp\|C0LGT1\|Y5129_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g10290	43.300%	Swiss-Prot	Medium
`Q6K4T4`	Oryza sativa subsp. japonica	sp\|Q6K4T4\|SERK4_ORYSJ LRR receptor kinase SERK2	39.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card