TkA05G411520 | RubberDandelionOmics

Gene overview

TkA05G411520

Reference: TK1151 Chr: Chr05 Coordinates: 102374706-102377673 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1411 bp · TkA05G411520|TK1151|cDNA

ACAAAACCTTCTTTCATGCTATCCCTGGTTCTTTTCCCATGAATCTAGCCTCTCTATTTGTTTGAATTAAACTGTTTCTTTTTCTTTTTTGTTCTTTTCAACGATCAAAATGGTGGGCGAGTCTACTTCGTTATTACCCGACTTCTTCGACACCTCCACCGTCGTAGCATCTCCCGACGACATCTTCAGTATTCTCGAGGCATTAGAAGGTGTTTCCGATGACTTCACCGCCTTCACACCAGCGGATTCTGGTGCCAAAA...

CDS

Download CDS FASTA

1041 bp · TkA05G411520|TK1151|CDS

ATGGTGGGCGAGTCTACTTCGTTATTACCCGACTTCTTCGACACCTCCACCGTCGTAGCATCTCCCGACGACATCTTCAGTATTCTCGAGGCATTAGAAGGTGTTTCCGATGACTTCACCGCCTTCACACCAGCGGATTCTGGTGCCAAAAAAGACGTCGGTCGTAACTTACACCGGTTAGCGTCCCAGAAGTCAACTTCTAATTCGAGCGCCGTACAGGAACTCGTGGAAGCTGAGCTTGAGGCGGCGTTTTCACCCAG...

Protein

Download Protein FASTA

346 aa · TkA05G411520|TK1151|PROTEIN

MVGESTSLLPDFFDTSTVVASPDDIFSILEALEGVSDDFTAFTPADSGAKKDVGRNLHRLASQKSTSNSSAVQELVEAELEAAFSPRSKKQKVASLSPAADQEGGENSDGNKMSHVTVERNRRKQMNEHLTVLRSLMPCFYVKRGDQASIIGGVIDYITELQQVLQSLEAKKQRKVYSDVLSPRLISSPRTLPLSPRKPPLSPRPLPISPRTPQSASPYRHRLPSSYLLSPSSMAVNNNYTTPPSPCNSSSNSDSINELV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G411520`
TK1151 ID	TkA05G411520
OH-1004 ID	LXL04_014554
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.200
Protein coverage (%)	TK1151 66.763 / OH-1004 45.673 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G411520

Location Chr05:102374706-102377673 (-)

Description Similar to FAMA: Transcription factor FAMA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53210`	Transcription factor acting as an integration node for stomata and brassinosteroid (BR) signaling pathways to control stomatal initiation and development.	Transcription factor control of asymmetric cell divisions that establish the stomatal lineage.2007 · DOI: 10.1038/nature05491 Termination of asymmetric cell division and differentiation of stomata.2007 · DOI: 10.1038/nature05467 SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848 SPEECHLESS integrates brassinosteroid and stomata signalling pathways.2012 · DOI: 10.1038/ncb2471 Phosphorylation of Serine 186 of bHLH Transcription Factor SPEECHLESS Promotes Stomatal Development in Arabidopsis.2015 · DOI: 10.1016/j.molp.2014.12.014 The BASL polarity protein controls a MAPK signaling feedback loop in asymmetric cell division.2015 · DOI: 10.1016/j.devcel.2015.02.022 A Mutation in the bHLH Domain of the SPCH Transcription Factor Uncovers a BR-Dependent Mechanism for Stomatal Development.2017 · DOI: 10.1104/pp.17.00615
`At3g24140`	Transcription activator.	Arabidopsis FAMA controls the final proliferation/differentiation switch during stomatal development.2006 · DOI: 10.1105/tpc.106.046136 Termination of asymmetric cell division and differentiation of stomata.2007 · DOI: 10.1038/nature05467 Deep functional redundancy between FAMA and FOUR LIPS in stomatal development.2014 · DOI: 10.1111/tpj.12489 Arabidopsis guard cell integrity involves the epigenetic stabilization of the FLP and FAMA transcription factor genes.2014 · DOI: 10.1111/tpj.12516
`At3g06120`	Transcription factor.	Termination of asymmetric cell division and differentiation of stomata.2007 · DOI: 10.1038/nature05467
`At5g46690`	Transcription factor.	No verified direct reference in this release
`At1g22490`	Transcription factor bHLH94.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014554 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0010377 guard cell fate commitment Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0045597 positive regulation of cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051782 negative regulation of cell division Biological Process

GO:0090547 response to low humidity Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G22490

ath:AT1G72210

ath:AT3G06120

ath:AT3G24140

ath:AT4G01460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkA05G411520 · TK1151

Cytoplasm0.125

Rank 2 · TkA05G411520 · TK1151

Cell membrane0.030

Rank 3 · TkA05G411520 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA05G411520 · TK1151

Plastid0.013

Rank 5 · TkA05G411520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08718GLTP28-87 aa

PF22754bHLH-TF_ACT-like_plant60-93 aa

PF00010HLH112-162 aa

PF23177bHLH_IRO3115-173 aa

PF23173bHLH_SAC51119-172 aa

PF22754bHLH-TF_ACT-like_plant290-342 aa

PF00010HLH305-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G411520	`PF08718`	GLTP	28	87	0.0085	17.0
TkA05G411520	`PF22754`	bHLH-TF_ACT-like_plant	60	93	0.0018	19.0
TkA05G411520	`PF00010`	HLH	112	162	2.1e-12	47.4
TkA05G411520	`PF23177`	bHLH_IRO3	115	173	0.0072	17.4
TkA05G411520	`PF23173`	bHLH_SAC51	119	172	0.17	12.5
TkA05G411520	`PF22754`	bHLH-TF_ACT-like_plant	290	342	0.0018	19.0
TkA05G411520	`PF00010`	HLH	305	313	2.1e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q700C7`	Arabidopsis thaliana	sp\|Q700C7\|SPCH_ARATH Transcription factor SPEECHLESS	48.400%	Swiss-Prot	Medium
`Q56YJ8`	Arabidopsis thaliana	sp\|Q56YJ8\|FAMA_ARATH Transcription factor FAMA	38.000%	Swiss-Prot	Medium
`Q9M8K6`	Arabidopsis thaliana	sp\|Q9M8K6\|MUTE_ARATH Transcription factor MUTE	76.200%	Swiss-Prot	Low
`Q56XR0`	Arabidopsis thaliana	sp\|Q56XR0\|BH071_ARATH Transcription factor bHLH71	32.900%	Swiss-Prot	Medium
`Q9SK91`	Arabidopsis thaliana	sp\|Q9SK91\|BH094_ARATH Transcription factor bHLH94	65.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card