TkA05G410730 | RubberDandelionOmics

Gene overview

TkA05G410730

Reference: TK1151 Chr: Chr05 Coordinates: 102175941-102181196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · TkA05G410730|TK1151|cDNA

CTCAAATATTTTTCCTCTCAATTTTTTCGTAGATCCTCTCCAGAATCCAGATCCTTCACAACTGTAAAGGGAACATAACAAAGTCATGAGTGAATCCAAGCTCAAGAATATGGCGACAAAAGTTTATGAAGCAATAGGTGTCCAACGATGGCTACCTTCAAGTCCACAATCTGAATCCATGTCAAAATCGAGACATGATCATGTGAATCGCGGCTACAGTACTACTACATCCAATCAACCAATCACAATCGACCAAACCT...

CDS

Download CDS FASTA

1059 bp · TkA05G410730|TK1151|CDS

ATGAGTGAATCCAAGCTCAAGAATATGGCGACAAAAGTTTATGAAGCAATAGGTGTCCAACGATGGCTACCTTCAAGTCCACAATCTGAATCCATGTCAAAATCGAGACATGATCATGTGAATCGCGGCTACAGTACTACTACATCCAATCAACCAATCACAATCGACCAAACCTACATTTCTTGGTTGAAAGAACACCCTTCGGCGATTACGTCATTCCAACAAATGATCAACGCATCAAAAGGGAAACAAATTGTCGT...

Protein

Download Protein FASTA

352 aa · TkA05G410730|TK1151|PROTEIN

MSESKLKNMATKVYEAIGVQRWLPSSPQSESMSKSRHDHVNRGYSTTTSNQPITIDQTYISWLKEHPSAITSFQQMINASKGKQIVVFLDYDGTLSPIVSDPECAFMSDQMRTAVRDVSNHFPTAIISGRSREKVFDFVKLKTVYYSGSHGMDTMGPAPKNVVYDNKYLQKISDNEGNDFIVFQPARDFLSAIEKMLREIKERTENIKGVVIEDNRFCLSVHYRHVKNEDYKKLEEELELLLVKNPGFHITTGNKVLEVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G410730`
TK1151 ID	TkA05G410730
OH-1004 ID	LXL04_021610
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G410730

Location Chr05:102175941-102181196 (+)

Description Similar to TPP7: Probable trehalose-phosphate phosphatase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35910`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At1g78090`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Trehalose-6-phosphate phosphatases from Arabidopsis thaliana: identification by functional complementation of the yeast tps2 mutant.1998 · DOI: 10.1046/j.1365-313x.1998.00064.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0369400`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os10g0553300`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os07g0624600`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021610 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0004805 trehalose-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78090

dosa:Os07g0624600

dosa:Os08g0409100

dosa:Os09g0369400

dosa:Os10g0553300

osa:4349333

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.530

Rank 1 · TkA05G410730 · TK1151

Nucleus0.307

Rank 2 · TkA05G410730 · TK1151

Mitochondrion0.167

Rank 3 · TkA05G410730 · TK1151

Cell membrane0.066

Rank 4 · TkA05G410730 · TK1151

Peroxisome0.065

Rank 5 · TkA05G410730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13426PAS_940-94 aa

PF08282Hydrolase_387-303 aa

PF02358Trehalose_PPase88-319 aa

PF29499BEM4_C168-239 aa

PF13426PAS_9183-232 aa

PF29243Tp0577_N186-238 aa

PF277352-thiour_desulf_put222-314 aa

PF13426PAS_9296-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G410730	`PF13426`	PAS_9	40	94	0.055	14.5
TkA05G410730	`PF08282`	Hydrolase_3	87	303	9.5e-05	23.0
TkA05G410730	`PF02358`	Trehalose_PPase	88	319	6.3e-58	196.4
TkA05G410730	`PF29499`	BEM4_C	168	239	0.17	11.8
TkA05G410730	`PF13426`	PAS_9	183	232	0.055	14.5
TkA05G410730	`PF29243`	Tp0577_N	186	238	0.069	13.8
TkA05G410730	`PF27735`	2-thiour_desulf_put	222	314	0.22	11.7
TkA05G410730	`PF13426`	PAS_9	296	319	0.055	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XC9`	Arabidopsis thaliana	sp\|Q67XC9\|TPPD_ARATH Probable trehalose-phosphate phosphatase D	51.700%	Swiss-Prot	High
`Q9C9S4`	Arabidopsis thaliana	sp\|Q9C9S4\|TPPB_ARATH Trehalose-phosphate phosphatase B	50.700%	Swiss-Prot	High
`Q6H5L4`	Oryza sativa subsp. japonica	sp\|Q6H5L4\|TPP7_ORYSJ Probable trehalose-phosphate phosphatase 7	50.700%	Swiss-Prot	High
`Q9FWQ2`	Oryza sativa subsp. japonica	sp\|Q9FWQ2\|TPP2_ORYSJ Probable trehalose-phosphate phosphatase 2	50.300%	Swiss-Prot	High
`Q7XI41`	Oryza sativa subsp. japonica	sp\|Q7XI41\|TPP3_ORYSJ Probable trehalose-phosphate phosphatase 3	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card