Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1756 bp · TkA05G405830|TK1151|cDNA
AAATAATATGCCTCGGACCCAACCTAGTAAATTCCATCTTTTGTCTGTTTTTGTCCGAAATTGATCATATTCTATGGCCTACAATTTGCGGTTCACACTTTATTGCTTATTCAGCAGCAAACCAGCTGCCACGTTGGCGGTTTTCTGTGGCTCGTCATCCTCGCGTCTCTTCCAAGTTTCGTCCTTATCCACAATACCCTAAATTCAAGCCTCCATCTTTCTAATACCTTTGCTCTAAAAACTCTAAAATCTCCGCTTCA...
1167 bp · TkA05G405830|TK1151|CDS
ATGTTGATGTTGCTGGGTCTTGTTGCGATTGCTTTCGTTTTCGGAATTATGGTAGGTTGGAAATGGAAACCCAGATGGGTCAAATTCGATTCGTTAGTACCTTCATCTGAATCATCTCCTTTAACTTCAACTGTCGATAATCAATTTGGGTCAAACCAGAACCTTAATCGTCAATCGTTACAAGTCGTGACCACCACGAATCCCGATTGCAGTTCATCAATTGTCAAAAAAGACGAGAACCATCTTCTTACAGATGAAGA...
Protein
Download Protein FASTA388 aa · TkA05G405830|TK1151|PROTEIN
MLMLLGLVAIAFVFGIMVGWKWKPRWVKFDSLVPSSESSPLTSTVDNQFGSNQNLNRQSLQVVTTTNPDCSSSIVKKDENHLLTDEDLKHLWQLVERKDNGPPWKHMMSRSTPNMHYQAWQRDPETGPPQYCSKTVYENAAPELMRDFFWDDEFRLKWDDMLLHAATMEEFQDSGTSVVHWIRKFPFFCSDREYTIGRRIWELEGSYYCVTKGVPCPSIPKKQKPRRVDLYYSSWFIQSAESKKCEVTFFHHEDMGIPWE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G405830 |
|---|---|
| TK1151 ID | TkA05G405830 |
| OH-1004 ID | LXL04_029442 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 46.300 |
| Protein coverage (%) | TK1151 96.649 / OH-1004 92.807Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G405830 |
|---|---|
| Location | Chr05:100951505-100956687 (+) |
| Description | Similar to Stard7: StAR-related lipid transfer protein 7, mitochondrial |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0006744 ubiquinone biosynthetic process Biological Process GO:0006869 lipid transport Biological Process GO:0007006 mitochondrial membrane organization Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0015914 phospholipid transport Biological Process GO:0042092 type 2 immune response Biological Process GO:0043457 regulation of cellular respiration Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:0120163 negative regulation of cold-induced thermogenesis Biological Process GO:0120197 mucociliary clearance Biological Process GO:0005576 extracellular region Cellular Component |
| KEGG gene cross-reference | hsa:56910 hsa:58488 mmu:99138 rno:29510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01852START100-255 aaPF01852START262-312 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G405830 | PF01852 | START | 100 | 255 | 2.5e-09 | 37.5 |
| TkA05G405830 | PF01852 | START | 262 | 312 | 2.5e-09 | 37.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.