TkA05G405700 | RubberDandelionOmics

Gene overview

TkA05G405700

Reference: TK1151 Chr: Chr05 Coordinates: 100909466-100911423 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · TkA05G405700|TK1151|cDNA

TTAAGATGCCGGCCGTACGTATACGGTTGGTGAATCTAACGTGTATATATAGAATGCTTCAACCATACTCACTCTCACACCAAAACGAACACAAACCCACAATACACACACTGACACACACACACTTCTCCGACGAAATGGGGTCAACCACAGCACCTGCAAGTTTTCCGGCGGAATCAAACCACGACGACGAAGCTTTCCTCTTCGCCATGAACCTAGCAACAGCATCCGTCTTACCAATGGTCGTGAAAACCGCCATC...

CDS

Download CDS FASTA

1227 bp · TkA05G405700|TK1151|CDS

ATGCCGGCCGTACGTATACGGTTGGTGAATCTAACGTGTATATATAGAATGCTTCAACCATACTCACTCTCACACCAAAACGAACACAAACCCACAATACACACACTGACACACACACACTTCTCCGACGAAATGGGGTCAACCACAGCACCTGCAAGTTTTCCGGCGGAATCAAACCACGACGACGAAGCTTTCCTCTTCGCCATGAACCTAGCAACAGCATCCGTCTTACCAATGGTCGTGAAAACCGCCATCGAGCT...

Protein

Download Protein FASTA

408 aa · TkA05G405700|TK1151|PROTEIN

MPAVRIRLVNLTCIYRMLQPYSLSHQNEHKPTIHTLTHTHFSDEMGSTTAPASFPAESNHDDEAFLFAMNLATASVLPMVVKTAIELNLLEIISKSGAGASLSSSDLASQIPNTNPEAPAMLERICSLLASHSVLTCTLKETDDGGVERLYGLAPVCKFLTKNENGVSLAPLLLMNQDKILMESWYHLKDAVVDGGIPFNKAYGMSAFEYHGKDQRFNKVFNSGMFNHSTMTMEKIVDLYDGFNGVKTLVDVGGGIGASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G405700`
TK1151 ID	TkA05G405700
OH-1004 ID	LXL04_021556
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 89.216 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G405700`
Location	Chr05:100909466-100911423 (+)
Description	Similar to Caffeic acid 3-O-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021556` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009805 coumarin biosynthetic process Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0047763 caffeate O-methyltransferase activity Molecular Function
KEGG gene cross-reference	cann:107862991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.816

Rank 1 · TkA05G405700 · TK1151

Nucleus0.324

Rank 2 · TkA05G405700 · TK1151

Endoplasmic reticulum0.060

Rank 3 · TkA05G405700 · TK1151

Cell membrane0.045

Rank 4 · TkA05G405700 · TK1151

Mitochondrion0.042

Rank 5 · TkA05G405700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08100Dimerisation69-162 aa

PF00891Methyltransf_2185-390 aa

PF13649Methyltransf_25207-230 aa

PF05891Methyltransf_PK243-345 aa

PF13489Methyltransf_23244-390 aa

PF08242Methyltransf_12250-337 aa

PF13649Methyltransf_25250-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G405700	`PF08100`	Dimerisation	69	162	2.9e-17	63.1
TkA05G405700	`PF00891`	Methyltransf_2	185	390	1.7e-73	247.1
TkA05G405700	`PF13649`	Methyltransf_25	207	230	0.14	13.6
TkA05G405700	`PF05891`	Methyltransf_PK	243	345	0.0064	16.8
TkA05G405700	`PF13489`	Methyltransf_23	244	390	0.012	16.0
TkA05G405700	`PF08242`	Methyltransf_12	250	337	0.097	14.1
TkA05G405700	`PF13649`	Methyltransf_25	250	336	0.14	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card