TkA05G398980 | RubberDandelionOmics

Gene overview

TkA05G398980

Reference: TK1151 Chr: Chr05 Coordinates: 99198024-99204970 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · TkA05G398980|TK1151|cDNA

ATGAGTTCGCAACTCAAGACAGGTTCGGATGATGCGGATGCGGATGAGTTCGCAACTCATGCGGATACGGATGAGTTCGCAACTCAAGACAGTTGGTGCACATTATTAGATGTGAATTACAGATTACTTTGGAACGTATACAAAGACCTATACGGAATTGGTGAGCTCTGTGATTGGCACATCGACAGTGTTCCAAAGGTTTCCGGCGAGTTTTCCGGTGAGGTCAGGCCACCACCGGCCACCCTATCCATGGTGGCAGG...

CDS

Download CDS FASTA

1095 bp · TkA05G398980|TK1151|CDS

ATGAGTTCGCAACTCAAGACAGGTTCGGATGATGCGGATGCGGATGAGTTCGCAACTCATGCGGATACGGATGAGTTCGCAACTCAAGACAGTTGGTGCACATTATTAGATGTGAATTACAGATTACTTTGGAACGTATACAAAGACCTATACGGAATTGGTGAGCTCTGTGATTGGCACATCGACAGTGTTCCAAAGGTTTCCGGCGAGTTTTCCGGTGAGGTCAGGCCACCACCGGCCACCCTATCCATGGTGGCAGG...

Protein

Download Protein FASTA

364 aa · TkA05G398980|TK1151|PROTEIN

MSSQLKTGSDDADADEFATHADTDEFATQDSWCTLLDVNYRLLWNVYKDLYGIGELCDWHIDSVPKVSGEFSGEVRPPPATLSMVAGGGGRLGCLGSVLTCVLLINGQNGTTAPVVSVLTETCTVTSLFTFEGFTGRKSGEEFQIFKDNLRYIEEHNSGEHSYKLGLNKFADLTNEEFRLGYTRAIPQLKSNDVKSDRYSLRSGDVLPDAVDWRSKGAVTPVKTQGKCGASWAFSAIGAVEGINQIATGNLITLSEQHLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G398980`
TK1151 ID	TkA05G398980
OH-1004 ID	LXL04_020413
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 60.440 / OH-1004 99.548 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G398980

Location Chr05:99198024-99204970 (-)

Description Similar to RD21B: Probable cysteine protease RD21B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43060`	Probable thiol protease.	No verified direct reference in this release
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release
`At3g19400`	Probable thiol protease.	No verified direct reference in this release
`At3g19390`	Probable thiol protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020413 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT3G19400

ath:AT5G43060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.328

Rank 1 · TkA05G398980 · TK1151

Extracellular0.273

Rank 2 · TkA05G398980 · TK1151

Cytoplasm0.237

Rank 3 · TkA05G398980 · TK1151

Endoplasmic reticulum0.152

Rank 4 · TkA05G398980 · TK1151

Cell membrane0.104

Rank 5 · TkA05G398980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246Inhibitor_I29141-178 aa

PF00112Peptidase_C1207-346 aa

PF08246Inhibitor_I29304-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G398980	`PF08246`	Inhibitor_I29	141	178	3.5e-15	56.8
TkA05G398980	`PF00112`	Peptidase_C1	207	346	2.6e-45	155.9
TkA05G398980	`PF08246`	Inhibitor_I29	304	313	3.5e-15	56.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMH8`	Arabidopsis thaliana	sp\|Q9FMH8\|RD21B_ARATH Probable cysteine protease RD21B	58.700%	Swiss-Prot	Medium
`P43297`	Arabidopsis thaliana	sp\|P43297\|RD21A_ARATH Cysteine proteinase RD21A	58.200%	Swiss-Prot	Medium
`Q9LT77`	Arabidopsis thaliana	sp\|Q9LT77\|RDL2_ARATH Probable cysteine protease RDL2	55.300%	Swiss-Prot	Medium
`Q9LT78`	Arabidopsis thaliana	sp\|Q9LT78\|RD21C_ARATH Probable cysteine protease RD21C	56.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card