TkA05G397710 | RubberDandelionOmics

Gene overview

TkA05G397710

Reference: TK1151 Chr: Chr05 Coordinates: 98858431-98865910 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1940 bp · TkA05G397710|TK1151|cDNA

ATAGCGTTGTAGAAAAATAAAATAAAGGAAAGTATACATGGTTGTTGACTTGTTGTAAAAAGTAATAAAAAAGCAGTATATCAATATTATCCTCTTCTTTCTCCTTTTGAGCATAGCAGTCTGATTTCAACTATAAATAGAAAGGGTCGATCCGCCATTTCTCCCAAAGATAGAGAAAACATGAGAAGGGTGCTGTTGCTGTTAATATTAGTATCGTCGGTGGTGGTAGGTGGTGCCAAAGAGGCGGAGGTCACCCGGAA...

CDS

Download CDS FASTA

1488 bp · TkA05G397710|TK1151|CDS

ATGAGAAGGGTGCTGTTGCTGTTAATATTAGTATCGTCGGTGGTGGTAGGTGGTGCCAAAGAGGCGGAGGTCACCCGGAATGACTTTCCCAAGGGGTTTGTGTTTGGAACGGCGACGTCCGCTTATCAGGTGGAGGGCATGGCCAGTAAAGGAGGACGAGGGCCCAGCATTTGGGATGAATTCATCAAGACTCCTGGACTTGAACCAAACAATGCCACAGGAGAAGTTTCAGTGGATCAGTATCATCGGTATAAGGAAGA...

Protein

Download Protein FASTA

495 aa · TkA05G397710|TK1151|PROTEIN

MRRVLLLLILVSSVVVGGAKEAEVTRNDFPKGFVFGTATSAYQVEGMASKGGRGPSIWDEFIKTPGLEPNNATGEVSVDQYHRYKEDIDMMANLNFDAYRFSISWSRIFPNGTGKVNPEGVAYYNRLIDYMLQKGITPYANLNHYDIPLALEKAYLGWLGHQVVEDYADYAEFCFKTFGDRVKNWLTFNEPRVVAALGYDNGFFAPGRCSKPYGNCTAGNSSTEPYIVAHNIILSHASAVRRYRRKYQEIQKGRIGILLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G397710`
TK1151 ID	TkA05G397710
OH-1004 ID	LXL04_037536
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.500
Protein coverage (%)	TK1151 94.343 / OH-1004 93.124 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G397710

Location Chr05:98858431-98865910 (+)

Description Similar to BGLU41: Putative beta-glucosidase 41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18080`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-mannoside, cellobiose, 4-methylumbelliferyl-beta-D-glucoside, laminarin, amygdalin, esculin and gentiobiose.	Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 1.2004 · DOI: 10.1007/s11103-004-0790-1
`At3g18070`	Beta-glucosidase 43.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0508000`	Beta-glucosidase 1.	No verified direct reference in this release
`Os07g0656200`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-mannoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides, laminari-oligosaccharides and sophorose.	No verified direct reference in this release
`Os03g0703100`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-mannoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides, laminari-oligosaccharides, sophorose and gentiobiose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037536 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

GO:0047782 coniferin beta-glucosidase activity Molecular Function

GO:0080079 cellobiose glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26560

ath:AT5G54570

dosa:Os03g0212800

dosa:Os06g0683300

dosa:Os10g0323500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.437

Rank 1 · TkA05G397710 · TK1151

Endoplasmic reticulum0.199

Rank 2 · TkA05G397710 · TK1151

Extracellular0.102

Rank 3 · TkA05G397710 · TK1151

Cytoplasm0.084

Rank 4 · TkA05G397710 · TK1151

Cell membrane0.084

Rank 5 · TkA05G397710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_126-492 aa

PF00150Cellulase80-179 aa

PF02332Phenol_Hydrox179-194 aa

PF02332Phenol_Hydrox265-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G397710	`PF00232`	Glyco_hydro_1	26	492	1.4e-152	509.1
TkA05G397710	`PF00150`	Cellulase	80	179	0.013	15.7
TkA05G397710	`PF02332`	Phenol_Hydrox	179	194	0.049	13.9
TkA05G397710	`PF02332`	Phenol_Hydrox	265	345	0.049	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV33`	Arabidopsis thaliana	sp\|Q9LV33\|BGL44_ARATH Beta-glucosidase 44	73.500%	Swiss-Prot	High
`Q9LV34`	Arabidopsis thaliana	sp\|Q9LV34\|BGL43_ARATH Beta-glucosidase 43	71.000%	Swiss-Prot	High
`Q5QMT0`	Oryza sativa subsp. japonica	sp\|Q5QMT0\|BGL01_ORYSJ Beta-glucosidase 1	71.700%	Swiss-Prot	High
`A3BMZ5`	Oryza sativa subsp. japonica	sp\|A3BMZ5\|BGL26_ORYSJ Beta-glucosidase 26	70.000%	Swiss-Prot	High
`Q75I94`	Oryza sativa subsp. japonica	sp\|Q75I94\|BGL08_ORYSJ Beta-glucosidase 8	63.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card