TkA05G397350 | RubberDandelionOmics

Gene overview

TkA05G397350

Reference: TK1151 Chr: Chr05 Coordinates: 98754751-98755944 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · TkA05G397350|TK1151|cDNA

ATGAAGGGTGGAGATGGTATCTCTAGCTACACTAACAACTCCTCCTATCAGAAGTCTCTTTCGGATGTTGCTATGTCACTCATCAACGAGGCTATTGCTGAGAAGCTTGATGTAGGCGCATGTGGATGTGGATCTCCTTTCCGTATTGCGGACTTGGGTTGTTCCGTTGGGCCCAACACTTTAATTGTCGTAGAAAACATTATAAAAGCCGTGAAACTCAAATATCATTCCTCCTCATTCCCACCACCAGAGTTCCAAGT...

CDS

Download CDS FASTA

1041 bp · TkA05G397350|TK1151|CDS

ATGAAGGGTGGAGATGGTATCTCTAGCTACACTAACAACTCCTCCTATCAGAAGTCTCTTTCGGATGTTGCTATGTCACTCATCAACGAGGCTATTGCTGAGAAGCTTGATGTAGGCGCATGTGGATGTGGATCTCCTTTCCGTATTGCGGACTTGGGTTGTTCCGTTGGGCCCAACACTTTAATTGTCGTAGAAAACATTATAAAAGCCGTGAAACTCAAATATCATTCCTCCTCATTCCCACCACCAGAGTTCCAAGT...

Protein

Download Protein FASTA

346 aa · TkA05G397350|TK1151|PROTEIN

MKGGDGISSYTNNSSYQKSLSDVAMSLINEAIAEKLDVGACGCGSPFRIADLGCSVGPNTLIVVENIIKAVKLKYHSSSFPPPEFQVFFNDHASNDFNTLFKTLPSNKQYHAAGVPGSFYTRLFPRASLHVIHSSFALHWLSKVPHEVTEEGSRAWNKGRLHYGGADNAVVVAYRQQYMKDMDGFLNDRAEEVVCGGMVVVLVPGRPNEVPHSECIANVLFEVLGCCLLAMAKEGKIEEDIVDSLNIPIYYSSPQELEEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G397350`
TK1151 ID	TkA05G397350
OH-1004 ID	LXL04_037298
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.300
Protein coverage (%)	TK1151 92.775 / OH-1004 88.860 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G397350

Location Chr05:98754751-98755944 (+)

Description Similar to IAMT1: Indole-3-acetate O-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38100`	Probable S-adenosylmethionine-dependent methyltransferase At5g38100.	No verified direct reference in this release
`At5g38780`	Probable S-adenosylmethionine-dependent methyltransferase At5g38780.	No verified direct reference in this release
`At5g37990`	Probable S-adenosylmethionine-dependent methyltransferase At5g37990.	No verified direct reference in this release
`At3g44860`	May catalyze the production of the insect juvenile hormone methyl farnesoate (MeFA) to trigger defense against insect herbivory.	An Arabidopsis thaliana methyltransferase capable of methylating farnesoic acid.2006 · DOI: 10.1016/j.abb.2005.08.006

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037298 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009851 auxin biosynthetic process Biological Process

GO:0009856 pollination Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0032259 methylation Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0000287 magnesium ion binding Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0010341 gibberellin carboxyl-O-methyltransferase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051749 indole acetic acid carboxyl methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G26420

ath:AT5G55250

ath:AT5G56300

dosa:Os04g0665200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.814

Rank 1 · TkA05G397350 · TK1151

Nucleus0.312

Rank 2 · TkA05G397350 · TK1151

Endoplasmic reticulum0.071

Rank 3 · TkA05G397350 · TK1151

Plastid0.051

Rank 4 · TkA05G397350 · TK1151

Cell membrane0.040

Rank 5 · TkA05G397350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03492Methyltransf_71-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G397350	`PF03492`	Methyltransf_7	1	343	2.2e-107	359.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS10`	Arabidopsis thaliana	sp\|Q9LS10\|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100	39.100%	Swiss-Prot	Medium
`Q9FKR0`	Arabidopsis thaliana	sp\|Q9FKR0\|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780	39.100%	Swiss-Prot	Medium
`Q9FKC8`	Arabidopsis thaliana	sp\|Q9FKC8\|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990	38.800%	Swiss-Prot	Medium
`Q9FYC4`	Arabidopsis thaliana	sp\|Q9FYC4\|FAMT_ARATH Farnesoic acid carboxyl-O-methyltransferase	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card