TkA05G384160 | RubberDandelionOmics

Gene overview

TkA05G384160

Reference: TK1151 Chr: Chr05 Coordinates: 95425113-95428079 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2027 bp · TkA05G384160|TK1151|cDNA

AAGTGATGAAAATAGTGACATAAAGATAATGTTAACCTATGTCACACCATTCCCCCCTATAAATTATGCATTTCAACACACAATAACTACACAGAAAAATGGAAGATACGATTAACACACAACAAAAAAACCATGATGCATCTGGCAAAAGGCCCAAAGGTGGCCTCATCACAATGCCCTTCATTTTTGCGAATGAGGTGTGTGAGAAGCTGGCGGTTGTGGGATTTCAAACGAATATGATCAGCTATTTAACACAACAA...

CDS

Download CDS FASTA

1770 bp · TkA05G384160|TK1151|CDS

ATGGAAGATACGATTAACACACAACAAAAAAACCATGATGCATCTGGCAAAAGGCCCAAAGGTGGCCTCATCACAATGCCCTTCATTTTTGCGAATGAGGTGTGTGAGAAGCTGGCGGTTGTGGGATTTCAAACGAATATGATCAGCTATTTAACACAACAACTCCATATGCCGATGACAACGGCTGCCAACACCCTAACCAACTTTGGTGGCACTGCCAGCTTGACACCTTTGCTCGGAGCTTTCATAGCCGACTCTTT...

Protein

Download Protein FASTA

589 aa · TkA05G384160|TK1151|PROTEIN

MEDTINTQQKNHDASGKRPKGGLITMPFIFANEVCEKLAVVGFQTNMISYLTQQLHMPMTTAANTLTNFGGTASLTPLLGAFIADSFAGRFWTITIASLIYQIGMISLTTSSILPNLRPPPCDNGQVCEQANTGQLAILYISLLLTAIGSGGIRPCVVAFGADQFDETDEKQKTSTWKFFNWYYFCMGVSMLVAVTVIVYIQDNVGWGWGLGVPSIAMALSVVAFVFGYPLYRNMDPSGSPFTRLVQVCVAAYKKRHLPM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G384160`
TK1151 ID	TkA05G384160
OH-1004 ID	LXL04_021382
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G384160

Location Chr05:95425113-95428079 (-)

Description Similar to NPF3.1: Protein NRT1/ PTR FAMILY 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68570`	May act as an efflux-type nitrite transporter.	A nitrite transporter associated with nitrite uptake by higher plant chloroplasts.2007 · DOI: 10.1093/pcp/pcm073
`At3g54140`	Peptide transporter.	AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At5g01180`	Peptide transporter.	AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At2g02040`	Peptide transporter.	No verified direct reference in this release
`At1g62200`	Protein NRT1/ PTR FAMILY 8.5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0015031 protein transport Biological Process

GO:0015833 peptide transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0042938 dipeptide transport Biological Process

GO:0042939 tripeptide transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G62200

ath:AT1G68570

ath:AT2G02040

ath:AT3G54140

ath:AT5G01180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.807

Rank 1 · TkA05G384160 · TK1151

Cytoplasm0.089

Rank 2 · TkA05G384160 · TK1151

Endoplasmic reticulum0.059

Rank 3 · TkA05G384160 · TK1151

Lysosome / Vacuole0.055

Rank 4 · TkA05G384160 · TK1151

Mitochondrion0.036

Rank 5 · TkA05G384160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_146-502 aa

PF00854PTR291-523 aa

PF31253DUF8845158-198 aa

PF17887Jak1_Phl168-229 aa

PF10066DUF2304171-247 aa

PF31253DUF8845337-398 aa

PF10066DUF2304367-433 aa

PF07690MFS_1454-513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G384160	`PF07690`	MFS_1	46	502	3.6e-11	43.3
TkA05G384160	`PF00854`	PTR2	91	523	5.5e-96	322.5
TkA05G384160	`PF31253`	DUF8845	158	198	3.1	8.3
TkA05G384160	`PF17887`	Jak1_Phl	168	229	0.048	14.3
TkA05G384160	`PF10066`	DUF2304	171	247	0.013	16.5
TkA05G384160	`PF31253`	DUF8845	337	398	3.1	8.3
TkA05G384160	`PF10066`	DUF2304	367	433	0.013	16.5
TkA05G384160	`PF07690`	MFS_1	454	513	3.6e-11	43.3
TkA05G384160	`PF31253`	DUF8845	533	561	3.1	8.3
TkA05G384160	`PF00854`	PTR2	548	566	5.5e-96	322.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX20`	Arabidopsis thaliana	sp\|Q9SX20\|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1	70.800%	Swiss-Prot	High
`Q9M390`	Arabidopsis thaliana	sp\|Q9M390\|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1	44.200%	Swiss-Prot	Medium
`Q9LFB8`	Arabidopsis thaliana	sp\|Q9LFB8\|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2	46.000%	Swiss-Prot	Medium
`P46032`	Arabidopsis thaliana	sp\|P46032\|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3	42.700%	Swiss-Prot	Medium
`Q93Z20`	Arabidopsis thaliana	sp\|Q93Z20\|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5	42.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card