TkA05G382020 | RubberDandelionOmics

Gene overview

TkA05G382020

Reference: TK1151 Chr: Chr05 Coordinates: 94889766-94890236 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA05G382020|TK1151|cDNA

ATGCAATCAACCAAAACACCAACTTTATCCTCAGACAGCCGGAAATACGAGTGCAAGTACTGCTGCCGTGAGTTTGCAAACTCACAGGCTCTCGGCGGCCACCAGAACGCACATAAAAAAGAGCGCCAACTGTTGAAGCGGGCTGAAATTCAAGCACCACCTCACCTCCTCTCACACGGCGGTCGAGGGATGATACTTCCGTCCACCGGGCTTCCATCTCCGTCGTGGGTCTTCATACCACGTATGGTACCAGGTTCTTT...

CDS

Download CDS FASTA

420 bp · TkA05G382020|TK1151|CDS

ATGCAATCAACCAAAACACCAACTTTATCCTCAGACAGCCGGAAATACGAGTGCAAGTACTGCTGCCGTGAGTTTGCAAACTCACAGGCTCTCGGCGGCCACCAGAACGCACATAAAAAAGAGCGCCAACTGTTGAAGCGGGCTGAAATTCAAGCACCACCTCACCTCCTCTCACACGGCGGTCGAGGGATGATACTTCCGTCCACCGGGCTTCCATCTCCGTCGTGGGTCTTCATACCACGTATGGTACCAGGTTCTTT...

Protein

Download Protein FASTA

139 aa · TkA05G382020|TK1151|PROTEIN

MQSTKTPTLSSDSRKYECKYCCREFANSQALGGHQNAHKKERQLLKRAEIQAPPHLLSHGGRGMILPSTGLPSPSWVFIPRMVPGSLLTPSGGREPYAGVGQSSSLGSSRPQSNRGSSHGEGGAAGFSDAFGLDLHLKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G382020`
TK1151 ID	TkA05G382020
OH-1004 ID	LXL04_021350
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 100.000 / OH-1004 82.105 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G382020

Location Chr05:94889766-94890236 (+)

Description Similar to GIS3: Zinc finger protein GIS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67030`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana.2013 · DOI: 10.1111/nph.12211 The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g68360`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	GLABROUS INFLORESCENCE STEMS3 (GIS3) regulates trichome initiation and development in Arabidopsis.2015 · DOI: 10.1111/nph.13218
`At1g10480`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin (GA).	Zinc finger protein5 is required for the control of trichome initiation by acting upstream of zinc finger protein8 in Arabidopsis.2011 · DOI: 10.1104/pp.111.180281 ZFP5 encodes a functionally equivalent GIS protein to control trichome initiation.2012 · DOI: 10.4161/psb.7.1.18404 A zinc finger protein gene ZFP5 integrates phytohormone signaling to control root hair development in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05094.x
`At3g58070`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin (GA).	No verified direct reference in this release
`At2g41940`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Integration of cytokinin and gibberellin signalling by Arabidopsis transcription factors GIS, ZFP8 and GIS2 in the regulation of epidermal cell fate.2007 · DOI: 10.1242/dev.005017

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021350 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G24625

ath:AT1G67030

ath:AT1G68360

ath:AT3G58070

ath:AT5G06650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA05G382020 · TK1151

Cytoplasm0.088

Rank 2 · TkA05G382020 · TK1151

Cell membrane0.023

Rank 3 · TkA05G382020 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA05G382020 · TK1151

Plastid0.008

Rank 5 · TkA05G382020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912zf-C2H2_616-41 aa

PF13894zf-C2H2_416-38 aa

PF13894zf-C2H2_4127-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G382020	`PF13912`	zf-C2H2_6	16	41	0.00021	21.9
TkA05G382020	`PF13894`	zf-C2H2_4	16	38	0.00031	21.9
TkA05G382020	`PF13894`	zf-C2H2_4	127	138	0.00031	21.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39265`	Arabidopsis thaliana	sp\|Q39265\|ZFP6_ARATH Zinc finger protein 6	57.600%	Swiss-Prot	Medium
`Q9C9H1`	Arabidopsis thaliana	sp\|Q9C9H1\|GIS3_ARATH Zinc finger protein GIS3	45.700%	Swiss-Prot	Medium
`Q39264`	Arabidopsis thaliana	sp\|Q39264\|ZFP5_ARATH Zinc finger protein 5	69.200%	Swiss-Prot	Low
`Q84WI0`	Arabidopsis thaliana	sp\|Q84WI0\|GIS_ARATH Zinc finger protein GIS	70.300%	Swiss-Prot	Low
`P93751`	Arabidopsis thaliana	sp\|P93751\|ZFP8_ARATH Zinc finger protein 8	59.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card