TkA05G379420 | RubberDandelionOmics

Gene overview

TkA05G379420

Reference: TK1151 Chr: Chr05 Coordinates: 94275406-94277399 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1524 bp · TkA05G379420|TK1151|cDNA

ATGTGGAAGTTACTAAATGGAGAATCGTATGATTGTGTCTTGATAGATGCTGACATACCTGAAATGGATATGGTGGATTTTCTCCACCAAACCTTTAAGCATCAACCTCATTTATCTATAATTAGTAAGATGATGACTTCTAATAACATTGACATGCGACTCTTTAAGGAAATTCTACAAAATGAGGCAGTTGTGTGTCTCCCAAAACCTTGTAATCCCAGAGACATTTGCAATATTTGGCAACATGTGTGTAGAAAGGG...

CDS

Download CDS FASTA

1524 bp · TkA05G379420|TK1151|CDS

ATGTGGAAGTTACTAAATGGAGAATCGTATGATTGTGTCTTGATAGATGCTGACATACCTGAAATGGATATGGTGGATTTTCTCCACCAAACCTTTAAGCATCAACCTCATTTATCTATAATTAGTAAGATGATGACTTCTAATAACATTGACATGCGACTCTTTAAGGAAATTCTACAAAATGAGGCAGTTGTGTGTCTCCCAAAACCTTGTAATCCCAGAGACATTTGCAATATTTGGCAACATGTGTGTAGAAAGGG...

Protein

Download Protein FASTA

507 aa · TkA05G379420|TK1151|PROTEIN

MWKLLNGESYDCVLIDADIPEMDMVDFLHQTFKHQPHLSIISKMMTSNNIDMRLFKEILQNEAVVCLPKPCNPRDICNIWQHVCRKGISFEGVNYSNGESPEENQEPNIFKRFDPVVKKSTTINPTLMNHSLSSSSSGSGTQDGLGINSQESGAMCKLLTYEELWRNDDDRKQPNEHKRTNDRQVEDDHRYCKQRKDTKKRITWTGDLHRKFVEAINLLGKEKAYPTTILDVMKVPGLTRSQVSSHLQKYQDHKKNIKNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G379420`
TK1151 ID	TkA05G379420
OH-1004 ID	LXL04_021315
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.300
Protein coverage (%)	TK1151 100.000 / OH-1004 90.830 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G379420

Location Chr05:94275406-94277399 (+)

Description Similar to APRR2: Two-component response regulator-like APRR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18020`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	No verified direct reference in this release
`At5g44190`	Transcriptional activator that functions with GLK1 to promote chloroplast development.	Arabidopsis GARP transcriptional activators interact with the Pro-rich activation domain shared by G-box-binding bZIP factors.2002 · DOI: 10.1093/pcp/pcf011 GLK gene pairs regulate chloroplast development in diverse plant species.2002 · DOI: 10.1046/j.1365-313x.2002.01390.x GLK transcription factors regulate chloroplast development in a cell-autonomous manner.2008 · DOI: 10.1111/j.1365-313x.2008.03616.x GLK transcription factors coordinate expression of the photosynthetic apparatus in Arabidopsis.2009 · DOI: 10.1105/tpc.108.065250 Specialization of the Golden2-like regulatory pathway during land plant evolution.2009 · DOI: 10.1111/j.1469-8137.2009.02829.x ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription.2013 · DOI: 10.1038/embor.2013.24

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q7Y0W3`	Transcriptional activator that acts as a floral inducer to promote short-day (SD) flowering pathway.	No verified direct reference in this release
`Os10g0463400`	Transcriptional activator that acts as a floral inducer to promote short-day (SD) flowering pathway.	Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1.2004 · DOI: 10.1101/gad.1189604
`Os01g0904700`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021315 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

KEGG gene cross-reference

ath:AT1G68210

ath:AT3G16857

ath:AT4G16110

ath:AT4G18020

ath:AT5G07210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA05G379420 · TK1151

Cytoplasm0.090

Rank 2 · TkA05G379420 · TK1151

Cell membrane0.031

Rank 3 · TkA05G379420 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA05G379420 · TK1151

Plastid0.013

Rank 5 · TkA05G379420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072Response_reg2-78 aa

PF00249Myb_DNA-binding203-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G379420	`PF00072`	Response_reg	2	78	3e-07	31.3
TkA05G379420	`PF00249`	Myb_DNA-binding	203	250	2e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6LA43`	Arabidopsis thaliana	sp\|Q6LA43\|APRR2_ARATH Two-component response regulator-like APRR2	25.300%	Swiss-Prot	Low
`Q9FFH0`	Arabidopsis thaliana	sp\|Q9FFH0\|GLK2_ARATH Transcription activator GLK2	52.500%	Swiss-Prot	Low
`Q7Y0W3`	Oryza sativa subsp. indica	sp\|Q7Y0W3\|EHD1_ORYSI Two-component response regulator EHD1	28.200%	Swiss-Prot	Low
`Q7Y0W5`	Oryza sativa subsp. japonica	sp\|Q7Y0W5\|EHD1_ORYSJ Two-component response regulator ORR30	28.200%	Swiss-Prot	Low
`Q5N6V8`	Oryza sativa subsp. japonica	sp\|Q5N6V8\|ORR26_ORYSJ Two-component response regulator ORR26	29.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card