TkA05G378720 | RubberDandelionOmics

Gene overview

TkA05G378720

Reference: TK1151 Chr: Chr05 Coordinates: 94079526-94083974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1797 bp · TkA05G378720|TK1151|cDNA

TTGCTTCGTAATTCTCTCTATCAAATAAAATCTGTCCCTTTGGTTTTCTGACTTTCTCTCTCTCTGGACCATCGTACTTTTTCTTCTCCCATATCACTGTTTTTTTCTCTCTCTGGCACCAATATATACATACACGTCCTATATAAGAGTATAAATTGAAAAGAGAAAAGAACCCAGTTACCTTTTAGCCTTTTAAACCCTTGGTTAATCATATACCAGCTTCAGTTCTTCACCGATATATTTCATCATTGAACGCTTTT...

CDS

Download CDS FASTA

1290 bp · TkA05G378720|TK1151|CDS

ATGGAACATAATAGTTATAGAAGAGGAGGAAGAAGAAGAGAACATATTATTCACTATAACATTAATGGCGGAGTGAGCACATCATCTACTGATGAAGAACTCGACCCATGGACAGCTTGGGCTTACAAGCCTCGAACCATTTCATTGCTATTCATCGGTGCATGTTTTCTTATTTGGGCAAGTGGAGCTCTTACTCCTGAAACTAGTTCATCGCCTGATCTTGTTACATCGGTCAAAAGGGGCATATGGGCAATGATTGC...

Protein

Download Protein FASTA

429 aa · TkA05G378720|TK1151|PROTEIN

MEHNSYRRGGRRREHIIHYNINGGVSTSSTDEELDPWTAWAYKPRTISLLFIGACFLIWASGALTPETSSSPDLVTSVKRGIWAMIAVFLTYCLLQAPSTLLIRPHPAIWRLVHGMAVIYLVALTFLLFQNRDDARQLMKYLDPDLGVELPERSYGADCRLYVADNPTSRFINVYDTLFDEFVPAHIFGWWGKAIMIRNQPLLWVLSIGFELMELTFRHMLPNFNECWWDSIILDILICNWFGIWAGMHTVRYFDGKTYE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G378720`
TK1151 ID	TkA05G378720
OH-1004 ID	LXL04_021309
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G378720

Location Chr05:94079526-94083974 (-)

Description Similar to PSS1: CDP-diacylglycerol--serine O-phosphatidyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15110`	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine.	PHOSPHATIDYLSERINE SYNTHASE1 is required for microspore development in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04624.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0118300`	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine.	No verified direct reference in this release
`Os05g0554400`	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine.	No verified direct reference in this release
`UniProt: Q5N8Q3`	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021309 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0006659 phosphatidylserine biosynthetic process Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0003882 CDP-diacylglycerol-serine O-phosphatidyltransferase activity Molecular Function

GO:0106245 L-serine-phosphatidylethanolamine phosphatidyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15110

dosa:Os01g0118300

dosa:Os01g0683500

dosa:Os05g0554400

mmu:27388

osa:4339554

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.708

Rank 1 · TkA05G378720 · TK1151

Golgi apparatus0.170

Rank 2 · TkA05G378720 · TK1151

Nucleus0.112

Rank 3 · TkA05G378720 · TK1151

Cytoplasm0.083

Rank 4 · TkA05G378720 · TK1151

Cell membrane0.075

Rank 5 · TkA05G378720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03034PSS105-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G378720	`PF03034`	PSS	105	386	3.6e-113	378.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HXY7`	Arabidopsis thaliana	sp\|F4HXY7\|PSS1_ARATH CDP-diacylglycerol--serine O-phosphatidyltransferase 1	79.400%	Swiss-Prot	High
`Q0JR55`	Oryza sativa subsp. japonica	sp\|Q0JR55\|PSS1_ORYSJ CDP-diacylglycerol--serine O-phosphatidyltransferase 1	80.000%	Swiss-Prot	High
`Q6I628`	Oryza sativa subsp. japonica	sp\|Q6I628\|PSS2_ORYSJ CDP-diacylglycerol--serine O-phosphatidyltransferase 2	77.600%	Swiss-Prot	High
`Q5N8Q3`	Oryza sativa subsp. japonica	sp\|Q5N8Q3\|PSS3_ORYSJ CDP-diacylglycerol--serine O-phosphatidyltransferase 3	80.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card