TkA05G377700 | RubberDandelionOmics

Gene overview

TkA05G377700

Reference: TK1151 Chr: Chr05 Coordinates: 93805315-93810835 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · TkA05G377700|TK1151|cDNA

GTTTAAACCATAGTGAAGATAAATATATGGCATCTTAAACATTATTTTACACTATAAAAATAGAGTAAATAATAAAAATGGATCGAAGATGCTCTTATATATTTGACCTCATTTTCCTCTTTGCTTCAATTCAACTTCGTGTTCCATTTGGTACAACTTAATCCCTTTGATACAACTTCTTTAAGTCTATTTAATACCAAATTCACTCCATACCTACAAAGATTGCTACCAAATTGTGATTGAGGTGACAGAGATGTTGC...

CDS

Download CDS FASTA

1230 bp · TkA05G377700|TK1151|CDS

ATGTTGCCAAAATTGATCATATTCCTCAGTTTATTGCTTATGGCCTCGGTATCGGCCATCTCAATCCTACCAAAGCCAGACAAAATCCTACCAAAGCCAGACAAGCCAAACAACACAACCAAGCCAAACAAGCCAAACAAGCCAACCAAGCCAGACAAACCAAATAAGTCAACCAAACCAGACAAACCAAACAAGCCAAACAAGCCAACCAAACCAACCAACACACGTGCTAAGTCAATGTTTGTGTTTGGAGATTCACT...

Protein

Download Protein FASTA

409 aa · TkA05G377700|TK1151|PROTEIN

MLPKLIIFLSLLLMASVSAISILPKPDKILPKPDKPNNTTKPNKPNKPTKPDKPNKSTKPDKPNKPNKPTKPTNTRAKSMFVFGDSLFDGGNNGLMKNCTIQANFPPYGSTFFKRPTGRFSNGRTVADFIAQFLGIELQKPYVEVNQQLTTGKRKDVPANGLNFASGGSGVLAATNKRLGVTALQVQTNQFQALIDKKLISKEQIANSLYIISSGSNDIFSYHLSLIKPVLFRSAQVDSMLKEVSGVLDKLCKIGARRIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G377700`
TK1151 ID	TkA05G377700
OH-1004 ID	LXL04_021289
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.300
Protein coverage (%)	TK1151 81.663 / OH-1004 86.632 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G377700

Location Chr05:93805315-93810835 (-)

Description Similar to GLIP6: GDSL esterase/lipase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71120`	GDSL esterase/lipase 6.	No verified direct reference in this release
`At1g53920`	GDSL esterase/lipase 5.	No verified direct reference in this release
`At4g16230`	GDSL esterase/lipase At4g16230.	No verified direct reference in this release
`At1g53940`	Involved in the resistance to the necrotropic bacteria Erwinia carotovora, probably via negative regulation of auxin signaling.	Arabidopsis GDSL lipase 2 plays a role in pathogen defense via negative regulation of auxin signaling.2009 · DOI: 10.1016/j.bbrc.2009.01.006
`At2g03980`	GDSL esterase/lipase At2g03980.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021289 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016412 serine O-acyltransferase activity Molecular Function

GO:0016746 acyltransferase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G53920

ath:AT1G71120

ath:AT4G16230

ath:AT5G45960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.604

Rank 1 · TkA05G377700 · TK1151

Endoplasmic reticulum0.123

Rank 2 · TkA05G377700 · TK1151

Cell membrane0.109

Rank 3 · TkA05G377700 · TK1151

Cytoplasm0.092

Rank 4 · TkA05G377700 · TK1151

Lysosome / Vacuole0.080

Rank 5 · TkA05G377700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12048DUF353030-75 aa

PF00657Lipase_GDSL81-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G377700	`PF12048`	DUF3530	30	75	0.32	11.0
TkA05G377700	`PF00657`	Lipase_GDSL	81	388	7.5e-34	118.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C996`	Arabidopsis thaliana	sp\|Q9C996\|GLIP6_ARATH GDSL esterase/lipase 6	49.600%	Swiss-Prot	Medium
`Q9SSA7`	Arabidopsis thaliana	sp\|Q9SSA7\|GLIP5_ARATH GDSL esterase/lipase 5	33.500%	Swiss-Prot	Medium
`O23470`	Arabidopsis thaliana	sp\|O23470\|GDL64_ARATH GDSL esterase/lipase At4g16230	36.400%	Swiss-Prot	Medium
`Q9SYF0`	Arabidopsis thaliana	sp\|Q9SYF0\|GLIP2_ARATH GDSL esterase/lipase 2	33.200%	Swiss-Prot	Medium
`Q9SIF5`	Arabidopsis thaliana	sp\|Q9SIF5\|GDL32_ARATH GDSL esterase/lipase At2g03980	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card