TkA05G373080 | RubberDandelionOmics

Gene overview

TkA05G373080

Reference: TK1151 Chr: Chr05 Coordinates: 92636309-92640979 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3129 bp · TkA05G373080|TK1151|cDNA

ATGGATTCGGATTGTAGGTCTCGCCCCCTACACATGTGGGGAGAAAGAAACTTCGAGGCAATAACAAAAGGCTTCAGGAGGACTATTGCACCCTTCGAAACCATCCATGCGAGGGTGGACCTCTCATGTGCTAAAATTGGTATTCTTACTGATAGGAAAGTCAGGATAAATAATGAGATGAAGGTCGAATACGGAGGAAAAATACTGAATATCGGAATCACGGAATTTGACGAAGATTGGTGGCCATTTTGTTTTGATCC...

CDS

Download CDS FASTA

3129 bp · TkA05G373080|TK1151|CDS

ATGGATTCGGATTGTAGGTCTCGCCCCCTACACATGTGGGGAGAAAGAAACTTCGAGGCAATAACAAAAGGCTTCAGGAGGACTATTGCACCCTTCGAAACCATCCATGCGAGGGTGGACCTCTCATGTGCTAAAATTGGTATTCTTACTGATAGGAAAGTCAGGATAAATAATGAGATGAAGGTCGAATACGGAGGAAAAATACTGAATATCGGAATCACGGAATTTGACGAAGATTGGTGGCCATTTTGTTTTGATCC...

Protein

Download Protein FASTA

1042 aa · TkA05G373080|TK1151|PROTEIN

MDSDCRSRPLHMWGERNFEAITKGFRRTIAPFETIHARVDLSCAKIGILTDRKVRINNEMKVEYGGKILNIGITEFDEDWWPFCFDPSKDFYEDESESCEEDDDEMSDTWMENEEMEEGEIREEDELASDHIVVEETVLNSKESDAPEPESIKIISPELDRNHDHPTEDPMNIMSLNVRGIAEDQKVTWVRRLKTQNRISYFGIQETQITDANSIDVDGCWDNSGFGYDATNSLGRSGGPLSIWDDTLYTAVEVKAEKAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G373080`
TK1151 ID	TkA05G373080
OH-1004 ID	LXL04_016670
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.200
Protein coverage (%)	TK1151 76.104 / OH-1004 47.339 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G373080

Location Chr05:92636309-92640979 (+)

Description Similar to RHM1: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016670 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009225 nucleotide-sugar metabolic process Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0010253 UDP-rhamnose biosynthetic process Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0019300 rhamnose biosynthetic process Biological Process

GO:0019305 dTDP-rhamnose biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G53500

ath:AT1G63000

ath:AT1G78570

ath:AT3G14790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.661

Rank 1 · TkA05G373080 · TK1151

Nucleus0.329

Rank 2 · TkA05G373080 · TK1151

Cell membrane0.095

Rank 3 · TkA05G373080 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA05G373080 · TK1151

Plastid0.038

Rank 5 · TkA05G373080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_1611-828 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G373080	`PF00078`	RVT_1	611	828	9.4e-17	62.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	28.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card