TkA05G372830 | RubberDandelionOmics

Gene overview

TkA05G372830

Reference: TK1151 Chr: Chr05 Coordinates: 92579466-92582443 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1609 bp · TkA05G372830|TK1151|cDNA

AAGGAAAGTTAGAGATCCAAACACCACCCAAGAAATGACTAAAGATGAAGACTTTAAGCTCCTCAAGATCCAGACTTGTATTCTCCGAGTGAATCTACACTGTGATGGATGCAAACACAAAGTGAAGAAACTCCTTCAGAAAATTGATGGTGTATATCAAGTGAATATAGATGCAGAACAGCAAAAAGTGACGGTTTCAGGAAGTGTGGACTCTGCGACTTTGATCAAGAAACTGGTTCGAGCCGGTAAACATGCTGAAC...

CDS

Download CDS FASTA

1347 bp · TkA05G372830|TK1151|CDS

ATGACTAAAGATGAAGACTTTAAGCTCCTCAAGATCCAGACTTGTATTCTCCGAGTGAATCTACACTGTGATGGATGCAAACACAAAGTGAAGAAACTCCTTCAGAAAATTGATGGTGTATATCAAGTGAATATAGATGCAGAACAGCAAAAAGTGACGGTTTCAGGAAGTGTGGACTCTGCGACTTTGATCAAGAAACTGGTTCGAGCCGGTAAACATGCTGAACTTTGGTCAAACAAGTCAAACCAAAATCAAACCCA...

Protein

Download Protein FASTA

448 aa · TkA05G372830|TK1151|PROTEIN

MTKDEDFKLLKIQTCILRVNLHCDGCKHKVKKLLQKIDGVYQVNIDAEQQKVTVSGSVDSATLIKKLVRAGKHAELWSNKSNQNQTQIKNQSQNHNQNQTTNHQNQKASCIKDDKQNKSRKQDFIKGLESLKSQQKFQSFNISEEDDDFLDDDDDDDDDEVNEEELRILTEKANQMVLLKQHQQLQQQHAAAMAANNVARSSHNNGGKPSNGGNGNGIGNGNGIGNGNGNGKKGNGIQNGGAKMGSNNNNKNNHGGGGEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G372830`
TK1151 ID	TkA05G372830
OH-1004 ID	LXL04_021257
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G372830

Location Chr05:92579466-92582443 (-)

Description Similar to HIPP37: Heavy metal-associated isoprenylated plant protein 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23000`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g06130`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g19090`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g05220`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g27690`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021257 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G23000

ath:AT3G05220

ath:AT3G06130

ath:AT5G19090

ath:AT5G27690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.591

Rank 1 · TkA05G372830 · TK1151

Cytoplasm0.344

Rank 2 · TkA05G372830 · TK1151

Cell membrane0.178

Rank 3 · TkA05G372830 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA05G372830 · TK1151

Lysosome / Vacuole0.020

Rank 5 · TkA05G372830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA17-73 aa

PF11705RNA_pol_3_Rpc3174-159 aa

PF04889Cwf_Cwc_1575-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G372830	`PF00403`	HMA	17	73	5.5e-16	59.4
TkA05G372830	`PF11705`	RNA_pol_3_Rpc31	74	159	7.4	7.2
TkA05G372830	`PF04889`	Cwf_Cwc_15	75	197	0.011	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVM8`	Arabidopsis thaliana	sp\|A2RVM8\|HIP37_ARATH Heavy metal-associated isoprenylated plant protein 37	78.200%	Swiss-Prot	Low
`Q9M8K5`	Arabidopsis thaliana	sp\|Q9M8K5\|HIP32_ARATH Heavy metal-associated isoprenylated plant protein 32	60.400%	Swiss-Prot	Low
`F4JZL7`	Arabidopsis thaliana	sp\|F4JZL7\|HIP33_ARATH Heavy metal-associated isoprenylated plant protein 33	61.100%	Swiss-Prot	Low
`Q0WV37`	Arabidopsis thaliana	sp\|Q0WV37\|HIP34_ARATH Heavy metal-associated isoprenylated plant protein 34	63.200%	Swiss-Prot	Low
`Q84J88`	Arabidopsis thaliana	sp\|Q84J88\|HIP36_ARATH Heavy metal-associated isoprenylated plant protein 36	57.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card