TkA05G368890 | RubberDandelionOmics

Gene overview

TkA05G368890

Reference: TK1151 Chr: Chr05 Coordinates: 91580353-91581247 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

800 bp · TkA05G368890|TK1151|cDNA

ATTTAATATTGAGTAGGAATCAAACTGAGGGCCACTAATTAAACAAAAATTATCAATATAAAGGCACAAGGAGCTCAAACCTATTTCGTAGTTCTCTTCTTTGCTTGTTCCATATATTTAAACAGATGAATCTAAGTACACTCGTCAAGCAAGTGACCATCAAATCTGATGGTGACGTGTTCCATGAAATCTTTAGACAAAGGCCACACCATATATCTGAAATGAGCCCTGGTTGCATTAAAGGCGTCAATCTACATGAT...

CDS

Download CDS FASTA

459 bp · TkA05G368890|TK1151|CDS

ATGAATCTAAGTACACTCGTCAAGCAAGTGACCATCAAATCTGATGGTGACGTGTTCCATGAAATCTTTAGACAAAGGCCACACCATATATCTGAAATGAGCCCTGGTTGCATTAAAGGCGTCAATCTACATGATGGCGAATGGGGTGTTGTTGGATCGGTCATCGTCTGGGACTTCATCCATGATGGGAAATCAAAAGTGGCTAAAGAAGTCATTGAAGCAATCGACGAGGAGAAAAAGTCAGTGTGCTTCAAGGTGAT...

Protein

Download Protein FASTA

152 aa · TkA05G368890|TK1151|PROTEIN

MNLSTLVKQVTIKSDGDVFHEIFRQRPHHISEMSPGCIKGVNLHDGEWGVVGSVIVWDFIHDGKSKVAKEVIEAIDEEKKSVCFKVIGGDILEAYKTFLITVHVDTNGEENIVTWTFHYEKLNEDIGEPNSLMDFCLTVTKDIENHHLPKSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G368890`
TK1151 ID	TkA05G368890
OH-1004 ID	LXL04_021224
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 78.351 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G368890

Location Chr05:91580353-91581247 (+)

Description Similar to Kirola

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70850`	MLP-like protein 34.	No verified direct reference in this release
`At1g70830`	Can bind steroids (in vitro), and may also bind other types of hydrophobic ligands.	Structures of two Arabidopsis thaliana major latex proteins represent novel helix-grip folds.2009 · DOI: 10.1002/prot.22396
`At1g70840`	MLP-like protein 31.	No verified direct reference in this release
`At1g70890`	MLP-like protein 43.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021224 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002253 activation of immune response Biological Process

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G70830

ath:AT1G70840

ath:AT1G70850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.856

Rank 1 · TkA05G368890 · TK1151

Nucleus0.279

Rank 2 · TkA05G368890 · TK1151

Cell membrane0.053

Rank 3 · TkA05G368890 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA05G368890 · TK1151

Mitochondrion0.040

Rank 5 · TkA05G368890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00407Bet_v_14-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G368890	`PF00407`	Bet_v_1	4	148	3.4e-42	144.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSK7`	Arabidopsis thaliana	sp\|Q9SSK7\|MLP34_ARATH MLP-like protein 34	45.200%	Swiss-Prot	Medium
`Q9SSK9`	Arabidopsis thaliana	sp\|Q9SSK9\|MLP28_ARATH MLP-like protein 28	45.500%	Swiss-Prot	Medium
`Q941R6`	Arabidopsis thaliana	sp\|Q941R6\|MLP31_ARATH MLP-like protein 31	44.100%	Swiss-Prot	Medium
`Q9SSK5`	Arabidopsis thaliana	sp\|Q9SSK5\|MLP43_ARATH MLP-like protein 43	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card