TkA05G355780 | RubberDandelionOmics

Gene overview

TkA05G355780

Reference: TK1151 Chr: Chr05 Coordinates: 88187788-88192981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1253 bp · TkA05G355780|TK1151|cDNA

ATTTTCATTTTCCAAAAAAAAAAAAGGAATAACACAAGAATAAGCACACTGCAGAAAGCAGCGAAAAGAAGCCATTTGAGATTCCATCTCCGCCAGGCGAAGGAGCGAATTTGGAGAATGGAACGGAGGAAAGAAGTGGTGGTTTCAGCTCTCCAGTTTGCTTGTTCGGACGATGTCGTCACTAACGTCGACACCGCCGAAAGGCTGGTGAGATCTGCTCACGAGAAGGGTGCTAATATCATCCTTATTCAGGAACTATT...

CDS

Download CDS FASTA

1437 bp · TkA05G355780|TK1151|CDS

ATGGAACGGAGGAAAGAAGTGGTGGTTTCAGCTCTCCAGTTTGCTTGTTCGGACGATGTCGTCACTAACGTCGACACCGCCGAAAGGCTGGTGAGATCTGCTCACGAGAAGGGTGCTAATATCATCCTTATTCAGGAACTATTCGAGGGCCATTACTTTTGTCAAGCACAAAGGGAAGATTTCTTTCAGCGAGCAAAACCTTACAAAGATCATCCAACCATTTCAAGGATGCAGAAACTTGCAAAGGAATTGGGAGTTGT...

Protein

Download Protein FASTA

478 aa · TkA05G355780|TK1151|PROTEIN

MERRKEVVVSALQFACSDDVVTNVDTAERLVRSAHEKGANIILIQELFEGHYFCQAQREDFFQRAKPYKDHPTISRMQKLAKELGVVIPVSFFEEANNAHYNSIAIIDADGTDLGIYRKSHIPDGPGYEEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAELLFYPTAIGSEPQDQGLDSRDHWKRVMQGHAGANLVPLVASNRVCKEVIKTEHGDSSITFYGNSFIAGPTGEIIAVANDKEEAVLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G355780`
TK1151 ID	TkA05G355780
OH-1004 ID	LXL04_021136
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 81.172 / OH-1004 94.344 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G355780

Location Chr05:88187788-88192981 (+)

Description Similar to CPA: N-carbamoylputrescine amidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27450`	Involved in polyamine biosynthesis.	No verified direct reference in this release
`At5g35525`	May be involved in heavy metals transport.	No verified direct reference in this release
`At1g14870`	Zinc transporter acting in both zinc extrusion and long-distance zinc transport.	Arabidopsis PCR2 is a zinc exporter involved in both zinc extrusion and long-distance zinc transport.2010 · DOI: 10.1105/tpc.109.070185

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0533900`	Involved in polyamine biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021136 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009446 putrescine biosynthetic process Biological Process

GO:0033388 putrescine biosynthetic process from arginine Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0047781 citrullinase activity Molecular Function

GO:0050126 N-carbamoylputrescine amidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G27450

dosa:Os02g0533900

ftu:FTT_0435

sly:544141

sot:102600318

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · TkA05G355780 · TK1151

Nucleus0.256

Rank 2 · TkA05G355780 · TK1151

Endoplasmic reticulum0.127

Rank 3 · TkA05G355780 · TK1151

Cell membrane0.111

Rank 4 · TkA05G355780 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA05G355780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00795CN_hydrolase19-272 aa

PF13079DUF391652-94 aa

PF13079DUF3916147-161 aa

PF04749PLAC8351-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G355780	`PF00795`	CN_hydrolase	19	272	1.2e-54	186.0
TkA05G355780	`PF13079`	DUF3916	52	94	0.24	12.0
TkA05G355780	`PF13079`	DUF3916	147	161	0.24	12.0
TkA05G355780	`PF04749`	PLAC8	351	402	1.1e-13	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYF5`	Arabidopsis thaliana	sp\|Q8VYF5\|NILP1_ARATH N-carbamoylputrescine amidase	88.400%	Swiss-Prot	Medium
`P0CW97`	Arabidopsis thaliana	sp\|P0CW97\|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3	58.300%	Swiss-Prot	High
`Q9LQU4`	Arabidopsis thaliana	sp\|Q9LQU4\|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2	54.000%	Swiss-Prot	High
`Q93XI4`	Oryza sativa subsp. japonica	sp\|Q93XI4\|AGUB_ORYSJ N-carbamoylputrescine amidase	81.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card