TkA05G343730 | RubberDandelionOmics

Gene overview

TkA05G343730

Reference: TK1151 Chr: Chr05 Coordinates: 85171059-85173260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1284 bp · TkA05G343730|TK1151|cDNA

AACAGAAAAAAAAATTTAAAAAGAAAGAAAGAAAGGAAAGCAAAATGGCATCGTCTGTTTTTTCGGAGTGGCGCCAAACGAAAACTAGAAACACACCAGATTTGGTATTCCCGCCATGGTTGGCGTCGATATCATCTTCCGCCATTCACAACAACAATCGCAGAAAGCAAACCCGTTCTTTTCTCTCTTTCTTTCTCGAAATGGATTTGTCGGAGATTGCAAGGAAGTTAGGGCTTAAGGAATCGAAGCAAGTCGTCCGT...

CDS

Download CDS FASTA

1017 bp · TkA05G343730|TK1151|CDS

ATGGCATCGTCTGTTTTTTCGGAGTGGCGCCAAACGAAAACTAGAAACACACCAGATTTGGTATTCCCGCCATGGTTGGCGTCGATATCATCTTCCGCCATTCACAACAACAATCGCAGAAAGCAAACCCGTTCTTTTCTCTCTTTCTTTCTCGAAATGGATTTGTCGGAGATTGCAAGGAAGTTAGGGCTTAAGGAATCGAAGCAAGTCGTCCGTAAAGCCGCTGAACTCCGTCGCGTCTCCGATCTTCAATTCGATTC...

Protein

Download Protein FASTA

338 aa · TkA05G343730|TK1151|PROTEIN

MASSVFSEWRQTKTRNTPDLVFPPWLASISSSAIHNNNRRKQTRSFLSFFLEMDLSEIARKLGLKESKQVVRKAAELRRVSDLQFDSSSAGIGEICKAVICLEIAANMKQVLIDRHTAIKLSGMSEKAYIRSFNVMQNGIGVKNRLDIRELAIQFGCVRLIPLVQKGLSLYRERFMASLPPSRRASTDCSRPVFTATGFYLCAKKHKLKVDKTKLIELSGSSEDEFSSVSTSMKDLCHDVFGVAQEKKDPKSVKVNRDLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G343730`
TK1151 ID	TkA05G343730
OH-1004 ID	LXL04_021034
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G343730

Location Chr05:85171059-85173260 (+)

Description Similar to ORC6: Origin of replication complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26840`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YNY4`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release
`Os07g0628600`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021034 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0009555 pollen development Biological Process

GO:0000808 origin recognition complex Cellular Component

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G26840

bta:515476

dosa:Os07g0628600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA05G343730 · TK1151

Cytoplasm0.088

Rank 2 · TkA05G343730 · TK1151

Cell membrane0.019

Rank 3 · TkA05G343730 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkA05G343730 · TK1151

Mitochondrion0.010

Rank 5 · TkA05G343730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08281Sigma70_r4_247-67 aa

PF05460ORC655-143 aa

PF21913ORC6_2nd91-133 aa

PF21913ORC6_2nd146-236 aa

PF05460ORC6161-235 aa

PF08281Sigma70_r4_2174-185 aa

PF08281Sigma70_r4_2258-268 aa

PF21925XRCC4_C264-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G343730	`PF08281`	Sigma70_r4_2	47	67	0.044	14.1
TkA05G343730	`PF05460`	ORC6	55	143	2.2e-24	86.3
TkA05G343730	`PF21913`	ORC6_2nd	91	133	5.3e-34	117.3
TkA05G343730	`PF21913`	ORC6_2nd	146	236	5.3e-34	117.3
TkA05G343730	`PF05460`	ORC6	161	235	2.2e-24	86.3
TkA05G343730	`PF08281`	Sigma70_r4_2	174	185	0.044	14.1
TkA05G343730	`PF08281`	Sigma70_r4_2	258	268	0.044	14.1
TkA05G343730	`PF21925`	XRCC4_C	264	323	3.5	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVH3`	Arabidopsis thaliana	sp\|Q9ZVH3\|ORC6_ARATH Origin of replication complex subunit 6	63.600%	Swiss-Prot	High
`A2YNY4`	Oryza sativa subsp. indica	sp\|A2YNY4\|ORC6_ORYSI Origin of replication complex subunit 6	62.600%	Swiss-Prot	High
`Q8GSL4`	Oryza sativa subsp. japonica	sp\|Q8GSL4\|ORC6_ORYSJ Origin of replication complex subunit 6	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card