TkA05G342690 | RubberDandelionOmics

Gene overview

TkA05G342690

Reference: TK1151 Chr: Chr05 Coordinates: 84877394-84882060 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2493 bp · TkA05G342690|TK1151|cDNA

TTTTGTTAAAGAAAAAAAGGTAAGAAATTGGAATCGAAATGGGACCACAATACCACATCACATGAGGGGGACTAATAAACGGCGATGCCGACATCATACTTCCCTTTCCGCGGATCTAAAGTAAATTATCCCTCCGGCCAAATTTGACCGTGGTTGAGTGTCGGTCACTTCGTCTACCCTCTACGTATTCTTCCGCTGTCAAAAGTCAACAGATATTCTCAAATCAACTCTAGATCTAATTCCATTGTAATGTGTAATGT...

CDS

Download CDS FASTA

1347 bp · TkA05G342690|TK1151|CDS

ATGCACTTCAAAATATGGAAGAAGACGGCCATTTATTTTAGTTGGATCTCTCATGATATCAATTGCTACATTGGATACTTGATTGGAGATACAAAGGAACATTGCAGTGTGTATAAAGGTACACGGACTAGGGCAGCTTTTGTCTTCATCATAGGCTTCTGGATGCTTGATCTTGCTAATAACACTGTTCAGGGTCCCGCTCGAGCTCTCCTAGCTGATTTAGCAGGCCCTGATCAAAGAAACTCAGCAAACGCTATATT...

Protein

Download Protein FASTA

448 aa · TkA05G342690|TK1151|PROTEIN

MHFKIWKKTAIYFSWISHDINCYIGYLIGDTKEHCSVYKGTRTRAAFVFIIGFWMLDLANNTVQGPARALLADLAGPDQRNSANAIFCSWMAIGNILGFLSGSSGNWHRWFPFLKSRACCEACGNLKAAFLVAVLFLTFCTLVTLYFAKEVPLAPKHKRLSDSAPLLNTNPQQNGAENSESKSVDQKVGQTTEIDEDQVESFNNSPGAVLVNLLTSLRHLPVGMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G342690`
TK1151 ID	TkA05G342690
OH-1004 ID	LXL04_021017
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 94.866 / OH-1004 73.024 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G342690

Location Chr05:84877394-84882060 (-)

Description Similar to SUC3: Sucrose transport protein SUC3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02860`	Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system).	AtSUC3, a gene encoding a new Arabidopsis sucrose transporter, is expressed in cells adjacent to the vascular tissue and in a carpel cell layer.2000 · DOI: 10.1046/j.1365-313x.2000.00934.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AF63`	Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system).	No verified direct reference in this release
`Os02g0827200`	Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system).	No verified direct reference in this release
`UniProt: Q9LKH3`	Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system).	No verified direct reference in this release
`Os03g0170900`	Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system).	Transport activity of rice sucrose transporters OsSUT1 and OsSUT5.2010 · DOI: 10.1093/pcp/pcp172 Disruption of a gene for rice sucrose transporter, OsSUT1, impairs pollen function but pollen maturation is unaffected.2010 · DOI: 10.1093/jxb/erq175 cDNA cloning and tissue specific expression of a gene for sucrose transporter from rice (Oryza sativa L.).1997 · DOI: 10.1093/oxfordjournals.pcp.a029134

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009846 pollen germination Biological Process

GO:0015768 maltose transport Biological Process

GO:0015770 sucrose transport Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005364 maltose:proton symporter activity Molecular Function

GO:0008506 sucrose:proton symporter activity Molecular Function

GO:0008515 sucrose transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G02860

dosa:Os02g0827200

dosa:Os03g0170900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.433

Rank 1 · TkA05G342690 · TK1151

Cell membrane0.265

Rank 2 · TkA05G342690 · TK1151

Cytoplasm0.183

Rank 3 · TkA05G342690 · TK1151

Endoplasmic reticulum0.134

Rank 4 · TkA05G342690 · TK1151

Golgi apparatus0.128

Rank 5 · TkA05G342690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80605`	Arabidopsis thaliana	sp\|O80605\|SUC3_ARATH Sucrose transport protein SUC3	69.200%	Swiss-Prot	High
`B8AF63`	Oryza sativa subsp. indica	sp\|B8AF63\|SUT4_ORYSI Sucrose transport protein SUT4	65.800%	Swiss-Prot	High
`Q6YK44`	Oryza sativa subsp. japonica	sp\|Q6YK44\|SUT4_ORYSJ Sucrose transport protein SUT4	65.800%	Swiss-Prot	High
`Q9LKH3`	Oryza sativa subsp. indica	sp\|Q9LKH3\|SUT1_ORYSI Sucrose transport protein SUT1	54.200%	Swiss-Prot	High
`Q10R54`	Oryza sativa subsp. japonica	sp\|Q10R54\|SUT1_ORYSJ Sucrose transport protein SUT1	54.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card