TkA05G337890 | RubberDandelionOmics

Gene overview

TkA05G337890

Reference: TK1151 Chr: Chr05 Coordinates: 83521939-83526395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2024 bp · TkA05G337890|TK1151|cDNA

AAATTTCTATCCGATGTGCTGTTTCACACTTAAATTAGAAATAGCGTCTCGGGATTTGATTCAAATATACAACTGATCTTCACTTCATCTGCCATACCAACAAATTCTGCCGCCGGAAAGGATTCCGTAGTGCTTTGATTTAATCTCCTCAGCTGTCATCTAAAATCCCCGATTACAAAAACCGCCATTAAAATCTGCCATTATTATCCTATTAATTCAGCATCAAGAACACATACACACGCATATTGAAAGTCTGGGGC...

CDS

Download CDS FASTA

1410 bp · TkA05G337890|TK1151|CDS

ATGGGGAAAGAAGGAATAAAGATGGAAGATAAATGGGGTTACGAGATCAACACCTCTTCCTCCTCTTGCATCTCTTCAATTAACTCTTATTATCACGAGATGCTTACCTATGGAAGAAAGAGGGCTGTGATAATGGAAGCAATCGATCATGATCCTAATTGTGTTTTAGCAAACATTTTGGCTGCCCATTTTTGCTGTTCTTCTGACCCTTCTCGAGTTCCTTCCCTTCTTCATGCTGCCAACACTAATCTCGAATATGC...

Protein

Download Protein FASTA

469 aa · TkA05G337890|TK1151|PROTEIN

MGKEGIKMEDKWGYEINTSSSSCISSINSYYHEMLTYGRKRAVIMEAIDHDPNCVLANILAAHFCCSSDPSRVPSLLHAANTNLEYATPYERAVFETIDCLISPNRDDDVAFELHSKLLNNFPKDLASLKRGQVLCFYIGRPDLSLQLIEQVLPANNEQDFVYGMLAFPLLELGRMEDAEKAAKKGFEINKEDPWSQHALCHVFQYECQFKKAVEFMEECSKSWGPLSSFMNTHNWWHVALCYLEGNAPFQKVREIYDNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G337890`
TK1151 ID	TkA05G337890
OH-1004 ID	LXL04_020991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G337890`
Location	Chr05:83521939-83526395 (+)
Description	Similar to ttc38: Tetratricopeptide repeat protein 38
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020991` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0070062 extracellular exosome Cellular Component
KEGG gene cross-reference	dre:553728 hsa:55020 mmu:239570 pon:100171430 xtr:448351 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.749

Rank 1 · TkA05G337890 · TK1151

Nucleus0.297

Rank 2 · TkA05G337890 · TK1151

Mitochondrion0.091

Rank 3 · TkA05G337890 · TK1151

Peroxisome0.052

Rank 4 · TkA05G337890 · TK1151

Cell membrane0.052

Rank 5 · TkA05G337890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13428TPR_1441-62 aa

PF29407CFAP70_TPR_C41-63 aa

PF14559TPR_1946-65 aa

PF00515TPR_146-54 aa

PF07719TPR_246-54 aa

PF13428TPR_14107-128 aa

PF00515TPR_1135-153 aa

PF13428TPR_14136-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G337890	`PF13428`	TPR_14	41	62	0.00018	22.6
TkA05G337890	`PF29407`	CFAP70_TPR_C	41	63	0.22	11.7
TkA05G337890	`PF14559`	TPR_19	46	65	0.021	15.9
TkA05G337890	`PF00515`	TPR_1	46	54	0.57	10.8
TkA05G337890	`PF07719`	TPR_2	46	54	8.7	7.5
TkA05G337890	`PF13428`	TPR_14	107	128	0.00018	22.6
TkA05G337890	`PF00515`	TPR_1	135	153	0.57	10.8
TkA05G337890	`PF13428`	TPR_14	136	167	0.00018	22.6
TkA05G337890	`PF07719`	TPR_2	136	153	8.7	7.5
TkA05G337890	`PF14559`	TPR_19	140	194	0.021	15.9
TkA05G337890	`PF31234`	TPR_Psidin_N	145	223	0.028	14.6
TkA05G337890	`PF13424`	TPR_12	145	191	0.48	11.4
TkA05G337890	`PF29407`	CFAP70_TPR_C	156	220	0.22	11.7
TkA05G337890	`PF13181`	TPR_8	163	192	0.069	14.1
TkA05G337890	`PF13424`	TPR_12	168	219	0.48	11.4
TkA05G337890	`PF13428`	TPR_14	170	201	0.00018	22.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card