TkA05G333510 | RubberDandelionOmics

Gene overview

TkA05G333510

Reference: TK1151 Chr: Chr05 Coordinates: 82139019-82139724 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA05G333510|TK1151|cDNA

ATGTCTCTTTCTAGAAACATTACGATTATCGTAGTGATTATTTTCGTAATATGTTTTTTGCTATACTTTTTTGTGAGATTTCTCATGAACAAGATAAGATTACATTCAAATTTTCATCATCAATCCACAAGATTTCACGAAAGTTCCGAAGGTGATGCTGATGTTTATCAAAGACAATTACAACAACTCTTCAAATTACATGATTCCGGATTGGATCAATCCTCCATTGATGCTCTCCCAGTGTTCGTTTACGAAGAATT...

CDS

Download CDS FASTA

573 bp · TkA05G333510|TK1151|CDS

ATGTCTCTTTCTAGAAACATTACGATTATCGTAGTGATTATTTTCGTAATATGTTTTTTGCTATACTTTTTTGTGAGATTTCTCATGAACAAGATAAGATTACATTCAAATTTTCATCATCAATCCACAAGATTTCACGAAAGTTCCGAAGGTGATGCTGATGTTTATCAAAGACAATTACAACAACTCTTCAAATTACATGATTCCGGATTGGATCAATCCTCCATTGATGCTCTCCCAGTGTTCGTTTACGAAGAATT...

Protein

Download Protein FASTA

190 aa · TkA05G333510|TK1151|PROTEIN

MSLSRNITIIVVIIFVICFLLYFFVRFLMNKIRLHSNFHHQSTRFHESSEGDADVYQRQLQQLFKLHDSGLDQSSIDALPVFVYEELVGLKEPLHCAVCLCEFTKKDNLRGNLFTPGFSVVNPVFDFDYDFDREEEEEIDHEGVSGNFKQCERKISKRWGKIAMEILMKGGVTRWGLMNILWGTPIYKLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G333510`
TK1151 ID	TkA05G333510
OH-1004 ID	LXL04_020923
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.500
Protein coverage (%)	TK1151 70.000 / OH-1004 86.096 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G333510

Location Chr05:82139019-82139724 (-)

Description Similar to ATL46: RING-H2 finger protein ATL46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40250`	RING-H2 finger protein ATL46.	No verified direct reference in this release
`At1g23980`	RING-H2 finger protein ATL47.	No verified direct reference in this release
`At4g30400`	RING-H2 finger protein ATL13.	No verified direct reference in this release
`At2g18650`	May be involved in female gametophyte development.	No verified direct reference in this release
`At3g48030`	RING-H2 finger protein ATL48.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020923 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23980

ath:AT2G18650

ath:AT3G48030

ath:AT4G30400

ath:AT5G40250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.361

Rank 1 · TkA05G333510 · TK1151

Nucleus0.269

Rank 2 · TkA05G333510 · TK1151

Cytoplasm0.240

Rank 3 · TkA05G333510 · TK1151

Golgi apparatus0.116

Rank 4 · TkA05G333510 · TK1151

Cell membrane0.115

Rank 5 · TkA05G333510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05434Tmemb_97-51 aa

PF10857DUF27017-27 aa

PF28082ZorA-like_t18-67 aa

PF28263MPN454_MG3198-64 aa

PF06129Chordopox_G39-39 aa

PF29506YCR043C11-56 aa

PF05434Tmemb_991-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G333510	`PF05434`	Tmemb_9	7	51	0.24	12.0
TkA05G333510	`PF10857`	DUF2701	7	27	6.2	7.6
TkA05G333510	`PF28082`	ZorA-like_t1	8	67	0.045	12.9
TkA05G333510	`PF28263`	MPN454_MG319	8	64	0.051	14.3
TkA05G333510	`PF06129`	Chordopox_G3	9	39	0.034	15.5
TkA05G333510	`PF29506`	YCR043C	11	56	0.25	12.2
TkA05G333510	`PF05434`	Tmemb_9	91	106	0.24	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL07`	Arabidopsis thaliana	sp\|Q9FL07\|ATL46_ARATH RING-H2 finger protein ATL46	42.900%	Swiss-Prot	Medium
`Q8GW38`	Arabidopsis thaliana	sp\|Q8GW38\|ATL47_ARATH RING-H2 finger protein ATL47	72.900%	Swiss-Prot	Low
`Q940Q4`	Arabidopsis thaliana	sp\|Q940Q4\|ATL13_ARATH RING-H2 finger protein ATL13	57.100%	Swiss-Prot	Low
`Q9ZV53`	Arabidopsis thaliana	sp\|Q9ZV53\|ATL49_ARATH Putative RING-H2 finger protein ATL49	67.300%	Swiss-Prot	Low
`Q7X843`	Arabidopsis thaliana	sp\|Q7X843\|ATL48_ARATH RING-H2 finger protein ATL48	62.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card