RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G332600
Reference: TK1151 Chr: Chr05 Coordinates: 81878948-81883839 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1790 bp · TkA05G332600|TK1151|cDNA

TAAATTACGAATTTCCATTTTTATTTTACTTTACTTGGCGCCAGGTATTTGCTCCACCACTTTACCACCACTCCAAAATTCCTGCAACATTCTCTTATTCCATCCATTAAACCCTATGATTCACTCTTTCTGTTCCTAAAATTCGAAGTTATTGATTGTTTTTAGTAAGGGAATCGGCGACTGTGACCGCGAATGGGAGCTTGTAGCAACGGAGGTAGCAACCACGCGTCGCCGTGGATGGAGGATCGACGGTTATGGAA...

CDS

Download CDS FASTA

1410 bp · TkA05G332600|TK1151|CDS

ATGGGAGCTTGTAGCAACGGAGGTAGCAACCACGCGTCGCCGTGGATGGAGGATCGACGGTTATGGAAGCACGTTCATGACAACGTCCATGGAAACATTTATCTCGATCCTCTCTCATTGAAATTTATTGACACCGAGCAGTTCCAAAGGCTTCGGGATTTGAAGCAACTTGGTTTATCACACATGGTATATCCTGGAGCAGTACATTCTAGATTTGAGCATTCACTTGGTGTTTATTGGCTTGCTGGTAATGCAGTTGA...

Protein

Download Protein FASTA

469 aa · TkA05G332600|TK1151|PROTEIN

MGACSNGGSNHASPWMEDRRLWKHVHDNVHGNIYLDPLSLKFIDTEQFQRLRDLKQLGLSHMVYPGAVHSRFEHSLGVYWLAGNAVEKLKAHQGLELDIDYSDIQTVKLAGLLHDVGHGPFSHLFEREFLPQVIQGSKWSHEEMSLNLIDYMVDEHNIDIDSGCLKKVKDMIIASSKNAPVKSSKEKLFLYDIVANGRNGIDVDKFDYIVRDSRACGLGCNFQFERLLDTMQVIDNEICYRAKEYLTVHKLFSTRADLHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G332600
TK1151 IDTkA05G332600
OH-1004 IDLXL04_020910
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)96.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G332600
LocationChr05:81878948-81883839 (+)
DescriptionSimilar to DDB_G0272484: Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020910 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006203 dGTP catabolic process Biological Process
GO:0006974 DNA damage response Biological Process
GO:0009264 deoxyribonucleotide catabolic process Biological Process
GO:0045087 innate immune response Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:0045540 regulation of cholesterol biosynthetic process Biological Process
GO:0046061 dATP catabolic process Biological Process
GO:0051289 protein homotetramerization Biological Process
GO:0051607 defense response to virus Biological Process
GO:0060339 negative regulation of type I interferon-mediated signaling pathway Biological Process
GO:0110025 DNA strand resection involved in replication fork processing Biological Process
KEGG gene cross-reference
bta:524683
ddi:DDB_G0272484
gga:419125
mmu:56045
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.692
Rank 1 · TkA05G332600 · TK1151
Cytoplasm0.337
Rank 2 · TkA05G332600 · TK1151
Mitochondrion0.099
Rank 3 · TkA05G332600 · TK1151
Cell membrane0.051
Rank 4 · TkA05G332600 · TK1151
Endoplasmic reticulum0.022
Rank 5 · TkA05G332600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01966HD71-161 aa
PF19276HD_assoc_2224-334 aa
PF12509DUF3715362-464 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G332600PF01966HD711614.5e-1040.6
TkA05G332600PF19276HD_assoc_22243341.6e-0628.5
TkA05G332600PF12509DUF37153624640.01715.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser