Gene Card
Gene overview
cDNA / CDS / Protein Sequences
903 bp · TkA05G324180|TK1151|cDNA
ATGCCTCGGAGATTGATTGGTTCATCAGAAGCTGCTTATCTTGCTGCTGGCTCTGTGCTTGATGTTGCTGCAAAAGTTGCAAAAGGGGAACTAAACTCTGCATTTGCCATTGTTAGACCTCCTGGACACCATGCAGAACAAAATGAACCAATGGGATTCTGCTTGTTCAACAATGAATTAGGTATCAACAAGATCTTAATCGTTGATTGGGATGTCCACCATGGAAATCCCATAGCTCATGCCATGACGGCGACCTTAAG...
903 bp · TkA05G324180|TK1151|CDS
ATGCCTCGGAGATTGATTGGTTCATCAGAAGCTGCTTATCTTGCTGCTGGCTCTGTGCTTGATGTTGCTGCAAAAGTTGCAAAAGGGGAACTAAACTCTGCATTTGCCATTGTTAGACCTCCTGGACACCATGCAGAACAAAATGAACCAATGGGATTCTGCTTGTTCAACAATGAATTAGGTATCAACAAGATCTTAATCGTTGATTGGGATGTCCACCATGGAAATCCCATAGCTCATGCCATGACGGCGACCTTAAG...
Protein
Download Protein FASTA300 aa · TkA05G324180|TK1151|PROTEIN
MPRRLIGSSEAAYLAAGSVLDVAAKVAKGELNSAFAIVRPPGHHAEQNEPMGFCLFNNELGINKILIVDWDVHHGNPIAHAMTATLSCWGSFWHVRISVFKSWVQQQWGQLSALLGKRLQWHFCHSAQKGSIRQQMRDKLLHEGLLLWDQIWNSRINCFRGQFWNFVTFWDCLEYRLLLASRRWWYLIVQKSQIYLLLVLIKGQFRRLLGGRTWNMLTFPLTDQNLYFGIKRWLFLSYAFCYQQRKRSRRGAGLKGIKLT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G324180 |
|---|---|
| TK1151 ID | TkA05G324180 |
| OH-1004 ID | LXL04_009765 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 93.333 / OH-1004 52.142Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G324180 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:79923412-79925402 (+) | |||||||||
| Description | Similar to HDA18: Histone deacetylase 18 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006325 chromatin organization Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0009908 flower development Biological Process GO:0010053 root epidermal cell differentiation Biological Process GO:0010592 positive regulation of lamellipodium assembly Biological Process GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling Biological Process GO:0010944 negative regulation of transcription by competitive promoter binding Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G61060 ath:AT5G61070 gga:374207 mmu:208727 rno:363287 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00850Hist_deacetyl8-83 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G324180 | PF00850 | Hist_deacetyl | 8 | 83 | 4.6e-23 | 82.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.