TkA05G318650 | RubberDandelionOmics

Gene overview

TkA05G318650

Reference: TK1151 Chr: Chr05 Coordinates: 78643985-78652896 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1726 bp · TkA05G318650|TK1151|cDNA

GGGAATTCAAGATGGTCAAAATTGGAATGCCATTCTCGACATTTAAAACATGGTTCTCACTAGCGACTGAATTGAGCAAATAGATAATATGTTCAACTGGTGTTCTGTATTTCTCTCTCATCAGTAGCCATCGATCCTTGTACTACCAATAATTGTTCTATAAGATATTAATAAGTGTTATTATATATGTGTTATGATTGAACCCATGATCGACCACTCCACCTAATTATCCCCAAACCCCTAATTTTTCACCGTGTGTT...

CDS

Download CDS FASTA

1161 bp · TkA05G318650|TK1151|CDS

ATGGACGGCGACAGAATTGAGGAAGCGACATTGGCGAATTCACCAGCTGATGAAATTTCGCATTTGGCTCTTGATATAGGAGGTTCTCTCATCAAGATGGTGTATTTCTCTACTGGTAGAGAAGAAGAAGAAGAACAACAACAACAACCTAATGGTAAAACACAAAAAGATGGACGTCTTCTTAATGGAAGGATTTCCTTTTTGAAATTTGAAACAAGCAAAATCAACGAATGCTTGGATTTTATTTCATCAAAACAGCT...

Protein

Download Protein FASTA

386 aa · TkA05G318650|TK1151|PROTEIN

MDGDRIEEATLANSPADEISHLALDIGGSLIKMVYFSTGREEEEEQQQQPNGKTQKDGRLLNGRISFLKFETSKINECLDFISSKQLRCSRGVQHSGFPASDKNIIKATGGGAFKFADLFKEKLNINLDKVEEMSSLVSGANFLLKAVPSEAFTYVNGQRNYVQIDHNDLYPYLLVNIGSGVSMIKVDGDGKFERVSGTSVGGGTFWGLGKLLTKCKSFDDLLEMSHQGNNRVIDMLVGDIYGGVDYLKIGLSSTAIASS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G318650`
TK1151 ID	TkA05G318650
OH-1004 ID	LXL04_020857
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G318650

Location Chr05:78643985-78652896 (+)

Description Similar to PANK2: Pantothenate kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60440`	Catalyzes the phosphorylation of pantothenate the first step in CoA biosynthesis.	4'-phosphopantetheine and coenzyme A biosynthesis in plants.2003 · DOI: 10.1074/jbc.m306321200 Plant coenzyme A biosynthesis: characterization of two pantothenate kinases from Arabidopsis.2006 · DOI: 10.1007/s11103-006-0037-4
`At4g32180`	Catalyzes the phosphorylation of pantothenate the first step in CoA biosynthesis.	Plant coenzyme A biosynthesis: characterization of two pantothenate kinases from Arabidopsis.2006 · DOI: 10.1007/s11103-006-0037-4

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0533100`	Catalyzes the phosphorylation of pantothenate the first step in CoA biosynthesis.	No verified direct reference in this release
`Os06g0207000`	Catalyzes the phosphorylation of pantothenate the first step in CoA biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015937 coenzyme A biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004594 pantothenate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G60440

ath:AT4G32180

dosa:Os06g0207000

dosa:Os09g0533100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561

Rank 1 · TkA05G318650 · TK1151

Nucleus0.509

Rank 2 · TkA05G318650 · TK1151

Cell membrane0.064

Rank 3 · TkA05G318650 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA05G318650 · TK1151

Lysosome / Vacuole0.043

Rank 5 · TkA05G318650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03630Fumble21-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G318650	`PF03630`	Fumble	21	354	7.2e-138	460.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80765`	Arabidopsis thaliana	sp\|O80765\|PANK1_ARATH Pantothenate kinase 1	74.300%	Swiss-Prot	High
`Q8L5Y9`	Arabidopsis thaliana	sp\|Q8L5Y9\|PANK2_ARATH Pantothenate kinase 2	65.500%	Swiss-Prot	High
`Q0J035`	Oryza sativa subsp. japonica	sp\|Q0J035\|PANK2_ORYSJ Pantothenate kinase 2	64.800%	Swiss-Prot	High
`Q69TF4`	Oryza sativa subsp. japonica	sp\|Q69TF4\|PANK1_ORYSJ Pantothenate kinase 1	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card