TkA05G311610 | RubberDandelionOmics

Gene overview

TkA05G311610

Reference: TK1151 Chr: Chr05 Coordinates: 76885271-76887318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1640 bp · TkA05G311610|TK1151|cDNA

AAACATTTGGGTCTACTTTGACAAAAAATAGTTACTTTGGGTCTAAACCAAAAAACAATCAAAATACAGGATCTTGGAAAAACACTTAAACGTAAATAATTAGAAAGAGCAGATGAGATTTGTTCTTACTCGATCAATTCGAGAACCCATCATCTTCTAGACGAGTTGAAGCTGAAGCTGTCTTCAGTCTAGCGATTAATGTTCCGTCGATGTACCATCCTGGCGTTTGTTAAAAGTCCCAAGTGAAAGTTTTACTTATC...

CDS

Download CDS FASTA

387 bp · TkA05G311610|TK1151|CDS

ATGGAGGAAGAGCAAGTGAAGACATATATCCCGACAATAATTAATGAATTTGCTTCAGCCGTCGAGAAACTTTATCAACAAGGAGCAAGAACATTTTGGATTCATAACACGGGTCCAATTGGTTGCCTACCATTTTTCGTAAAAAAAACTACACCAACTCCCGAAAACACAGACCAAATCGGATGTGTAAAATCATACAACAATTATCACAAGAATTCAACAAAAAACTCAAAGACAAAGTTTCACAACTTAAAACACAC...

Protein

Download Protein FASTA

128 aa · TkA05G311610|TK1151|PROTEIN

MEEEQVKTYIPTIINEFASAVEKLYQQGARTFWIHNTGPIGCLPFFVKKTTPTPENTDQIGCVKSYNNYHKNSTKNSKTKFHNLKHTFRNIVCVCRHLFGQILPHKSSKQPWICGSSWAVFRARWEFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G311610`
TK1151 ID	TkA05G311610
OH-1004 ID	LXL04_013262
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.200
Protein coverage (%)	TK1151 50.000 / OH-1004 16.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G311610

Location Chr05:76885271-76887318 (-)

Description Similar to At5g14450: GDSL esterase/lipase At5g14450

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14450`	GDSL esterase/lipase At5g14450.	No verified direct reference in this release
`At1g67830`	Hydrolyzes alpha-1,2-linked fucose.	AtFXG1, an Arabidopsis gene encoding alpha-L-fucosidase active against fucosylated xyloglucan oligosaccharides.2002 · DOI: 10.1104/pp.128.1.247
`At1g56670`	GDSL esterase/lipase LIP-4.	No verified direct reference in this release
`At1g54790`	GDSL esterase/lipase At1g54790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013262 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006581 acetylcholine catabolic process Biological Process

GO:0009877 nodulation Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043659 symbiosome Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function

GO:0052689 carboxylic ester hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G26430

ath:AT5G14450

mtr:25482476

zma:606473

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.720

Rank 1 · TkA05G311610 · TK1151

Cytoplasm0.114

Rank 2 · TkA05G311610 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA05G311610 · TK1151

Lysosome / Vacuole0.048

Rank 4 · TkA05G311610 · TK1151

Nucleus0.039

Rank 5 · TkA05G311610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL3-73 aa

PF11288DUF308950-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G311610	`PF00657`	Lipase_GDSL	3	73	1.4e-07	32.6
TkA05G311610	`PF11288`	DUF3089	50	79	0.045	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY84`	Arabidopsis thaliana	sp\|Q9LY84\|GDL76_ARATH GDSL esterase/lipase At5g14450	54.300%	Swiss-Prot	Medium
`Q9FXE5`	Arabidopsis thaliana	sp\|Q9FXE5\|FUCO3_ARATH Alpha-L-fucosidase 3	46.900%	Swiss-Prot	Medium
`Q9FXB6`	Arabidopsis thaliana	sp\|Q9FXB6\|LIP4_ARATH GDSL esterase/lipase LIP-4	49.200%	Swiss-Prot	Low
`Q3ECP6`	Arabidopsis thaliana	sp\|Q3ECP6\|GDL22_ARATH GDSL esterase/lipase At1g54790	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card