TkA05G308540 | RubberDandelionOmics

Gene overview

TkA05G308540

Reference: TK1151 Chr: Chr05 Coordinates: 76143046-76144916 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA05G308540|TK1151|cDNA

ATGCTAACGTCCAATAGTTTGTCTAGACCTGAATATGTATGGCAAAAAACATGGGAAATGTTGTCTGATAGAATTTTGTACACTCAACAAATGAAATTAAAGTCTCCAGATTTATCTCTTACAAACGAGCAACTTAGAAACATGACGCTGTATGAAATAGAGAAAATTTTGCTTCGGAACAATTCAAGTCTAAAACGATTTGATGGAATGTCATATCCTATTCATGATTTGGTATCATCTTTAAACATTCGTTTGATTAC...

CDS

Download CDS FASTA

684 bp · TkA05G308540|TK1151|CDS

ATGCTAACGTCCAATAGTTTGTCTAGACCTGAATATGTATGGCAAAAAACATGGGAAATGTTGTCTGATAGAATTTTGTACACTCAACAAATGAAATTAAAGTCTCCAGATTTATCTCTTACAAACGAGCAACTTAGAAACATGACGCTGTATGAAATAGAGAAAATTTTGCTTCGGAACAATTCAAGTCTAAAACGATTTGATGGAATGTCATATCCTATTCATGATTTGGTATCATCTTTAAACATTCGTTTGATTAC...

Protein

Download Protein FASTA

227 aa · TkA05G308540|TK1151|PROTEIN

MLTSNSLSRPEYVWQKTWEMLSDRILYTQQMKLKSPDLSLTNEQLRNMTLYEIEKILLRNNSSLKRFDGMSYPIHDLVSSLNIRLITEELAYEQRFVFDDIMKAVDEKKGGTFFIYGYGRIGKTFLLKTLSTSIRSKGEIVTNVASSGIASLLLAGGRTSHSRFRIPLNLNEDSICSIKPGSDVAKLLEKTSLYEMKLQRFINMHLRRWIERSRIYFPLIYGKIAKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G308540`
TK1151 ID	TkA05G308540
OH-1004 ID	LXL04_005692
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.800
Protein coverage (%)	TK1151 85.022 / OH-1004 13.666 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G308540`
Location	Chr05:76143046-76144916 (+)
Description	Similar to pif1: ATP-dependent DNA helicase pif1 (Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005692` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0051276 chromosome organization Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0031981 nuclear lumen Cellular Component
KEGG gene cross-reference	bba:Bd3546 cje:Cj0945c rno:367645 tbr:Tb11.01.6420 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.720

Rank 1 · TkA05G308540 · TK1151

Cytoplasm0.212

Rank 2 · TkA05G308540 · TK1151

Mitochondrion0.061

Rank 3 · TkA05G308540 · TK1151

Extracellular0.020

Rank 4 · TkA05G308540 · TK1151

Cell membrane0.018

Rank 5 · TkA05G308540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970PIF190-193 aa

PF01637ATPase_2100-141 aa

PF13191AAA_16100-137 aa

PF13481AAA_25109-155 aa

PF01637ATPase_2206-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G308540	`PF05970`	PIF1	90	193	7.5e-38	131.1
TkA05G308540	`PF01637`	ATPase_2	100	141	0.022	15.3
TkA05G308540	`PF13191`	AAA_16	100	137	0.25	12.5
TkA05G308540	`PF13481`	AAA_25	109	155	0.24	11.7
TkA05G308540	`PF01637`	ATPase_2	206	223	0.022	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card