TkA05G308420 | RubberDandelionOmics

Gene overview

TkA05G308420

Reference: TK1151 Chr: Chr05 Coordinates: 76112414-76115892 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2242 bp · TkA05G308420|TK1151|cDNA

CGCAACTTCACTCCTTCTTTCTCTCTCTCTTCTCTTACTTTCTCTTTCTAAAAACTCCGAAAACCGCATTTTGGCAACATAGCTGTTGCAGATTATTCCCTTTCACCATTCTCACCACCACCAACCACCACACATCTCCATCGTACGCCGGAGTTCTCTCTGTTTTAATACAATATACATCAAGTAGCTGATACTCTTGAATCTGGTTCTACGAGTTTCTTTGATTTGAGATCTGGAAGATCTAGAATGTCTAAAATATG...

CDS

Download CDS FASTA

1575 bp · TkA05G308420|TK1151|CDS

ATGTCTAAAATATGGGGGAATATCGGCGCCTGGGCGGCGGAAGCGGAGCGTGCAGAAGAGGAAGAGAAAGAACAAGAGGCCGCTGCGGCGGCGGCAGCCGCGGCTGCCCCACCACAGAGTTATCCGAGCTTGAAAGAGGCGGTAAACTCTAACAAAGGAAAGAAAAAGACGAAGATGACCTTGCAGGAGTTCACGATGGCCGGAGCTGGGAGTATCGGCGGTGGAGGTGCGCGCCGTGACATGGCTTTCGAGCATAATGG...

Protein

Download Protein FASTA

524 aa · TkA05G308420|TK1151|PROTEIN

MSKIWGNIGAWAAEAERAEEEEKEQEAAAAAAAAAAPPQSYPSLKEAVNSNKGKKKTKMTLQEFTMAGAGSIGGGGARRDMAFEHNGLTPEEMMRLPTGPKERSAEEMQYGRLGGGFSSYGGGRSGGGPRMRERDADGDGSWGNNRRSYGGFDDDRRGPPSRVSEFDQPSRADEVDNWAMAKKPMTPSYDAGSRPNRYSSLGGGGGLSTGGGGGGGGGFSRADEIDNWAMNKKPVPPPPARSSNFGSGFRDSGGPEPDRW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G308420`
TK1151 ID	TkA05G308420
OH-1004 ID	LXL04_020809
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G308420

Location Chr05:76112414-76115892 (+)

Description Similar to EIF4B1: Eukaryotic translation initiation factor 4B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13020`	Promotes the eIF4F and eIF4A RNA-dependent ATP-hydrolysis activity with different efficiency depending on mRNAs, thus providing mRNA discrimination during initiation of translation.	No verified direct reference in this release
`At3g26400`	Promotes the eIF4F and eIF4A RNA-dependent ATP-hydrolysis activity with different efficiency depending on mRNAs, thus providing mRNA discrimination during initiation of translation.	No verified direct reference in this release
`At4g38710`	Promotes the eIF4F and eIF4A RNA-dependent ATP-hydrolysis activity with different efficiency depending on mRNAs, thus providing mRNA discrimination during initiation of translation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020809 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G13020

ath:AT3G26400

ath:AT4G38710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.764

Rank 1 · TkA05G308420 · TK1151

Nucleus0.354

Rank 2 · TkA05G308420 · TK1151

Cell membrane0.087

Rank 3 · TkA05G308420 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA05G308420 · TK1151

Golgi apparatus0.031

Rank 5 · TkA05G308420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06273eIF-4B1-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G308420	`PF06273`	eIF-4B	1	499	1.7e-190	635.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAD7`	Arabidopsis thaliana	sp\|Q9SAD7\|IF4B2_ARATH Eukaryotic translation initiation factor 4B2	48.300%	Swiss-Prot	Medium
`Q9LIN5`	Arabidopsis thaliana	sp\|Q9LIN5\|IF4B1_ARATH Eukaryotic translation initiation factor 4B1	50.000%	Swiss-Prot	High
`Q9SZP8`	Arabidopsis thaliana	sp\|Q9SZP8\|IF4B3_ARATH Eukaryotic translation initiation factor 4B3	33.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card