TkA05G304290 | RubberDandelionOmics

Gene overview

TkA05G304290

Reference: TK1151 Chr: Chr05 Coordinates: 75061233-75062219 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · TkA05G304290|TK1151|cDNA

ATGGAAGAAGCCATGAGAAGACTTGCCGGATACACCGCCTCATCCGAATCTGATCTCTTTCAAACCCCAACTCCCTCCGTCCAGAAAAGATGCAATAACTCCGGTACCACCAACTCCGCCGCTAACAAAAGACTGGGACTAAAAGACGGCAATGCAACCAACAGCTCCATGAGATACCGCGGAGTCCGCCGCCGCCCGTGGGGTCGGTACGCTGCCGAGATACGTGACCCTCAGTCCAAAGAACGCCGGTGGCTTGGAAC...

CDS

Download CDS FASTA

957 bp · TkA05G304290|TK1151|CDS

ATGGAAGAAGCCATGAGAAGACTTGCCGGATACACCGCCTCATCCGAATCTGATCTCTTTCAAACCCCAACTCCCTCCGTCCAGAAAAGATGCAATAACTCCGGTACCACCAACTCCGCCGCTAACAAAAGACTGGGACTAAAAGACGGCAATGCAACCAACAGCTCCATGAGATACCGCGGAGTCCGCCGCCGCCCGTGGGGTCGGTACGCTGCCGAGATACGTGACCCTCAGTCCAAAGAACGCCGGTGGCTTGGAAC...

Protein

Download Protein FASTA

318 aa · TkA05G304290|TK1151|PROTEIN

MEEAMRRLAGYTASSESDLFQTPTPSVQKRCNNSGTTNSAANKRLGLKDGNATNSSMRYRGVRRRPWGRYAAEIRDPQSKERRWLGTFDTAEEAACAYDCAARAMRGSKARTNFVYPPPPSDGLINPFTFNNKTQSQPLPSSQYNTPFNSLLFHDFFNSGSSSSFCNSGASLSGCSPTTSVQVSKACTAAPVLSNQDDYKDFFPSEPDRSGLLDEVLTGFYPKPERQAKPELKAVSGPESNPFGFFFENPNRISSAPPSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G304290`
TK1151 ID	TkA05G304290
OH-1004 ID	LXL04_020774
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G304290

Location Chr05:75061233-75062219 (+)

Description Similar to ESR2: Ethylene-responsive transcription factor ESR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24590`	Required for correct embryo patterning and cotyledon organogenesis.	A new role for the Arabidopsis AP2 transcription factor, LEAFY PETIOLE, in gibberellin-induced germination is revealed by the misexpression of a homologous gene, SOB2/DRN-LIKE.2006 · DOI: 10.1105/tpc.105.036707 The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development.2006 · DOI: 10.1093/pcp/pcl023 The AP2 transcription factors DORNROSCHEN and DORNROSCHEN-LIKE redundantly control Arabidopsis embryo patterning via interaction with PHAVOLUTA.2007 · DOI: 10.1242/dev.001016
`At1g12980`	Regulates gene expression patterns in meristems and thus modulates organ development.	No verified direct reference in this release
`At5g13910`	Cell division-promoting factor involved in leaf blade differentiation, inflorescence branching, as well as in carpel and silique shape.	No verified direct reference in this release
`At1g28160`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g18560`	Probably acts as a transcriptional activator.	The auxin-regulated AP2/EREBP gene PUCHI is required for morphogenesis in the early lateral root primordium of Arabidopsis.2007 · DOI: 10.1105/tpc.107.050674 A role for Arabidopsis PUCHI in floral meristem identity and bract suppression.2009 · DOI: 10.1105/tpc.109.067025 The AP2/EREBP gene PUCHI Co-Acts with LBD16/ASL18 and LBD18/ASL20 downstream of ARF7 and ARF19 to regulate lateral root development in Arabidopsis.2013 · DOI: 10.1093/pcp/pct081

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020774 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0009908 flower development Biological Process

GO:0010030 positive regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT1G12980

ath:AT1G24590

ath:AT1G28160

ath:AT5G13910

ath:AT5G18560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA05G304290 · TK1151

Cytoplasm0.105

Rank 2 · TkA05G304290 · TK1151

Cell membrane0.025

Rank 3 · TkA05G304290 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA05G304290 · TK1151

Plastid0.017

Rank 5 · TkA05G304290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP258-108 aa

PF26003Integrase_N_phage62-94 aa

PF26003Integrase_N_phage127-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G304290	`PF00847`	AP2	58	108	6.8e-13	49.4
TkA05G304290	`PF26003`	Integrase_N_phage	62	94	0.11	13.3
TkA05G304290	`PF26003`	Integrase_N_phage	127	135	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYK5`	Arabidopsis thaliana	sp\|Q9FYK5\|ESR2_ARATH Ethylene-responsive transcription factor ESR2	46.200%	Swiss-Prot	Medium
`Q9SAD4`	Arabidopsis thaliana	sp\|Q9SAD4\|ESR1_ARATH Ethylene-responsive transcription factor ESR1	40.800%	Swiss-Prot	Medium
`Q9M644`	Arabidopsis thaliana	sp\|Q9M644\|LEP_ARATH Ethylene-responsive transcription factor LEP	76.500%	Swiss-Prot	Low
`Q9FZ90`	Arabidopsis thaliana	sp\|Q9FZ90\|ERF87_ARATH Ethylene-responsive transcription factor ERF087	59.300%	Swiss-Prot	Low
`Q6J9Q2`	Arabidopsis thaliana	sp\|Q6J9Q2\|ERF86_ARATH Ethylene-responsive transcription factor ERF086	78.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card