TkA05G302050 | RubberDandelionOmics

Gene overview

TkA05G302050

Reference: TK1151 Chr: Chr05 Coordinates: 74507785-74508177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA05G302050|TK1151|cDNA

ATGCCACCGGAACCAGACAAAGCCACTCCTGATCCAGGAGACAGTTCCATTTTCCGGAGGTTTCTCCAACGACAACCGTTGTACCTGTCCTCTTCAGCGGCATTACGGGAGTTTTCCCGACCTAGTGGTGAGAAGCTGTTGGAGAGGCTTAAAGAAATGGACATTGCTACAAACTGTATTCGTATCGACGGAATTATTAGTCCTCCATCATTGACGGTGGTTGATGCTAAGAAATTCCGTAGGGCTTCGCAAATGGAGAT...

CDS

Download CDS FASTA

393 bp · TkA05G302050|TK1151|CDS

ATGCCACCGGAACCAGACAAAGCCACTCCTGATCCAGGAGACAGTTCCATTTTCCGGAGGTTTCTCCAACGACAACCGTTGTACCTGTCCTCTTCAGCGGCATTACGGGAGTTTTCCCGACCTAGTGGTGAGAAGCTGTTGGAGAGGCTTAAAGAAATGGACATTGCTACAAACTGTATTCGTATCGACGGAATTATTAGTCCTCCATCATTGACGGTGGTTGATGCTAAGAAATTCCGTAGGGCTTCGCAAATGGAGAT...

Protein

Download Protein FASTA

130 aa · TkA05G302050|TK1151|PROTEIN

MPPEPDKATPDPGDSSIFRRFLQRQPLYLSSSAALREFSRPSGEKLLERLKEMDIATNCIRIDGIISPPSLTVVDAKKFRRASQMEIIISKLRNCVILFISSTNSPAISSSYEVCYPNQPLDTTSRVLLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G302050`
TK1151 ID	TkA05G302050
OH-1004 ID	LXL04_020751
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G302050

Location Chr05:74507785-74508177 (-)

Description Similar to At2g23790: Calcium uniporter protein 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36820`	Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020751 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0070509 calcium ion import Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:1990246 uniplex complex Cellular Component

GO:0005262 calcium channel activity Molecular Function

GO:0015292 uniporter activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G23790

ath:AT4G36820

ath:AT5G66650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.308

Rank 1 · TkA05G302050 · TK1151

Cytoplasm0.296

Rank 2 · TkA05G302050 · TK1151

Cell membrane0.192

Rank 3 · TkA05G302050 · TK1151

Mitochondrion0.187

Rank 4 · TkA05G302050 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA05G302050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PE15`	Arabidopsis thaliana	sp\|Q1PE15\|MCU4_ARATH Calcium uniporter protein 4, mitochondrial	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card