TkA05G299800 | RubberDandelionOmics

Gene overview

TkA05G299800

Reference: TK1151 Chr: Chr05 Coordinates: 73947151-73956562 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2201 bp · TkA05G299800|TK1151|cDNA

CACAATTCCATATGCAGTAATACAATATTCAATCTTTGCACTTCCTTTGTGTTGACATATCCGCCTTTTTCTTTCTTTATTTCTTTCTTCTTCTTCCTCCTATTTTCAACTCATTTTCACGTTGATAAGTTCCGATTTCATGTAAACGTCTCCAATTTTTCAAGCAACGTTCCTAAGATAGCCATGAAATCTCTGCTCCACAATACAGTTCCCTCAATCAACCACTCGTTCCCAATCAAATCTTCATCGATTGAATTTAA...

CDS

Download CDS FASTA

1959 bp · TkA05G299800|TK1151|CDS

CACAATTCCATATGCAGTAATACAATATTCAATCTTTGCACTTCCTTTGTGTTGACATATCCGCCTTTTTCTTTCTTTATTTCTTTCTTCTTCTTCCTCCTATTTTCAACTCATTTTCACGTTGATAAGTTCCGATTTCATGTAAACGTCTCCAATTTTTCAAGCAACGTTCCTAAGATAGCCATGAAATCTCTGCTCCACAATACAGTTCCCTCAATCAACCACTCGTTCCCAATCAAATCTTCATCGATTGAATTTAA...

Protein

Download Protein FASTA

652 aa · TkA05G299800|TK1151|PROTEIN

HNSICSNTIFNLCTSFVLTYPPFSFFISFFFFLLFSTHFHVDKFRFHVNVSNFSSNVPKIAMKSLLHNTVPSINHSFPIKSSSIEFNSRQYIQFPNDAKFLLSRQQKRQLTVKAVLDSAAVDNDFGLTESDVRNPTLSTSFQRPRDRKPNQTVLEAQTRVCTGPTQTKPLTEAQAFKVLDTILRSAKGELKDEEHVSKAQLGAFFAAMTIRANTFPEATQWSEGEKRAMDAYWPHLVRTLPSDIIFLADPEGSMMRLGSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G299800`
TK1151 ID	TkA05G299800
OH-1004 ID	LXL04_020733
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 90.644 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G299800`
Location	Chr05:73947151-73956562 (+)
Description	Similar to trpD: Anthranilate phosphoribosyltransferase (Aquifex aeolicus (strain VF5)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020733` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000162 L-tryptophan biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004048 anthranilate phosphoribosyltransferase activity Molecular Function
KEGG gene cross-reference	aae:aq_196 amt:Amet_1079 bwe:BcerKBAB4_1146 esi:Exig_0924 rsd:TGRD_118 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.942

Rank 1 · TkA05G299800 · TK1151

Mitochondrion0.074

Rank 2 · TkA05G299800 · TK1151

Cytoplasm0.046

Rank 3 · TkA05G299800 · TK1151

Nucleus0.031

Rank 4 · TkA05G299800 · TK1151

Peroxisome0.021

Rank 5 · TkA05G299800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02885Glycos_trans_3N168-219 aa

PF02885Glycos_trans_3N279-338 aa

PF00591Glycos_transf_3410-511 aa

PF00591Glycos_transf_3562-638 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G299800	`PF02885`	Glycos_trans_3N	168	219	1.7e-07	31.6
TkA05G299800	`PF02885`	Glycos_trans_3N	279	338	1.7e-07	31.6
TkA05G299800	`PF00591`	Glycos_transf_3	410	511	0.0032	17.9
TkA05G299800	`PF00591`	Glycos_transf_3	562	638	0.0032	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card