TkA05G299440 | RubberDandelionOmics

Gene overview

TkA05G299440

Reference: TK1151 Chr: Chr05 Coordinates: 73855246-73864866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA05G299440|TK1151|cDNA

TTACTTCTTTCACCTATATTCCATATATTTGCTTCGAGGTCGCCAGTTTCCATTCAACAGGGAGTAGAAGAAGCAAGTGAGAGGTTGACCGCACTTCAAAATACGGAGAGTTACAACAACTTAGAAGAGATTCACCAATCTGTGTTGAAAGAATTACCGCCTGAAATACAAGAAGAATTTCGTACTTTAATTCGACCTAAAAAACGAGCAAACAAGGTGAAGCGGGGGTCTAACATCGCGCATTACTTTTCCCTAAATAG...

CDS

Download CDS FASTA

327 bp · TkA05G299440|TK1151|CDS

TTACTTCTTTCACCTATATTCCATATATTTGCTTCGAGGTCGCCAGTTTCCATTCAACAGGGAGTAGAAGAAGCAAGTGAGAGGTTGACCGCACTTCAAAATACGGAGAGTTACAACAACTTAGAAGAGATTCACCAATCTGTGTTGAAAGAATTACCGCCTGAAATACAAGAAGAATTTCGTACTTTAATTCGACCTAAAAAACGAGCAAACAAGGTGAAGCGGGGGTCTAACATCGCGCATTACTTTTCCCTAAATAG...

Protein

Download Protein FASTA

108 aa · TkA05G299440|TK1151|PROTEIN

LLLSPIFHIFASRSPVSIQQGVEEASERLTALQNTESYNNLEEIHQSVLKELPPEIQEEFRTLIRPKKRANKVKRGSNIAHYFSLNREIPKKIVKRYLCIWTDFRRSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G299440`
TK1151 ID	TkA05G299440
OH-1004 ID	LXL04_014298
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.200
Protein coverage (%)	TK1151 67.593 / OH-1004 10.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G299440`
Location	Chr05:73855246-73864866 (+)
Description	Similar to POLH: DNA polymerase eta
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014298` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000731 DNA synthesis involved in DNA repair Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006290 pyrimidine dimer repair Biological Process GO:0006301 DNA damage tolerance Biological Process GO:0006302 double-strand break repair Biological Process GO:0009314 response to radiation Biological Process GO:0009650 UV protection Biological Process GO:0010224 response to UV-B Biological Process GO:0010225 response to UV-C Biological Process GO:0019985 translesion synthesis Biological Process GO:0042276 error-prone translesion synthesis Biological Process
KEGG gene cross-reference	ath:AT5G44740 dme:Dmel_CG7143 hsa:5429 mmu:80905 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.269

Rank 1 · TkA05G299440 · TK1151

Cytoplasm0.237

Rank 2 · TkA05G299440 · TK1151

Mitochondrion0.229

Rank 3 · TkA05G299440 · TK1151

Nucleus0.182

Rank 4 · TkA05G299440 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA05G299440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28776DUF84595-44 aa

PF29491Teflon_middle19-103 aa

PF12917YfbR-like36-78 aa

PF14377UBM42-59 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G299440	`PF28776`	DUF8459	5	44	0.18	12.9
TkA05G299440	`PF29491`	Teflon_middle	19	103	0.03	15.2
TkA05G299440	`PF12917`	YfbR-like	36	78	0.11	12.9
TkA05G299440	`PF14377`	UBM	42	59	0.0087	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card