TkA05G297600 | RubberDandelionOmics

Gene overview

TkA05G297600

Reference: TK1151 Chr: Chr05 Coordinates: 73389402-73390637 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

877 bp · TkA05G297600|TK1151|cDNA

AAAAAAAAACATGGCTCATTGTCATTCAACCCTCCCGGTGTTTATTCAAAGAACAGCAACCCCCAACTCAAATCCTTCATCTTTAGTTATGATCCCAAGTACAAACAAAAAGAGTCCTAGGTACACCATCATCAAAGCAGAAGCAGGAAACAGGGATCAATTAAAGAAATTTAGCATCAAGAATCAACAACCCATCAAGAAAAGAGTCGCCCAATCCCCACCAATTGGATTATGGGACAGATATCCTACAGCAAGAACAG...

CDS

Download CDS FASTA

708 bp · TkA05G297600|TK1151|CDS

ATGGCTCATTGTCATTCAACCCTCCCGGTGTTTATTCAAAGAACAGCAACCCCCAACTCAAATCCTTCATCTTTAGTTATGATCCCAAGTACAAACAAAAAGAGTCCTAGGTACACCATCATCAAAGCAGAAGCAGGAAACAGGGATCAATTAAAGAAATTTAGCATCAAGAATCAACAACCCATCAAGAAAAGAGTCGCCCAATCCCCACCAATTGGATTATGGGACAGATATCCTACAGCAAGAACAGTACAACAAAT...

Protein

Download Protein FASTA

235 aa · TkA05G297600|TK1151|PROTEIN

MAHCHSTLPVFIQRTATPNSNPSSLVMIPSTNKKSPRYTIIKAEAGNRDQLKKFSIKNQQPIKKRVAQSPPIGLWDRYPTARTVQQMMDTMDRLMEDPLAYANGGNGGAWGSQGQGTSSYSRGRTPWEIKEGEEEYKLRFDMPGMTKEDVKVWVEEKMLVLKAEKVKKDNNGESNGEDIDEGEWSSKSFGRYSFRIALPENIQFEKIRAEVRDGVLYVTIPKAPVSSKVLDISVQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G297600`
TK1151 ID	TkA05G297600
OH-1004 ID	LXL04_020710
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G297600

Location Chr05:73389402-73390637 (+)

Description Similar to HSP21: Heat shock protein 21, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27670`	Chaperone protein required for seedling and chloroplast development under heat stress, probably by maintaining plastid-encoded RNA polymerase (PEP)-dependent transcription.	Chloroplast small heat shock protein HSP21 interacts with plastid nucleoid protein pTAC5 and is essential for chloroplast development in Arabidopsis under heat stress.2013 · DOI: 10.1105/tpc.113.111229

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009507 chloroplast Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0101031 protein folding chaperone complex Cellular Component

KEGG gene cross-reference

ath:AT4G27670

sly:544024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · TkA05G297600 · TK1151

Nucleus0.033

Rank 2 · TkA05G297600 · TK1151

Mitochondrion0.032

Rank 3 · TkA05G297600 · TK1151

Cytoplasm0.026

Rank 4 · TkA05G297600 · TK1151

Cell membrane0.017

Rank 5 · TkA05G297600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011HSP20128-235 aa

PF17886ArsA_HSP20134-219 aa

PF27746Small_heat_shock_put138-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G297600	`PF00011`	HSP20	128	235	1.7e-20	73.7
TkA05G297600	`PF17886`	ArsA_HSP20	134	219	8.1e-07	29.3
TkA05G297600	`PF27746`	Small_heat_shock_put	138	221	9.1e-05	22.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P31170`	Arabidopsis thaliana	sp\|P31170\|HS25P_ARATH Heat shock protein 21, chloroplastic	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card