TkA05G294910 | RubberDandelionOmics

Gene overview

TkA05G294910

Reference: TK1151 Chr: Chr05 Coordinates: 72792781-72793158 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · TkA05G294910|TK1151|cDNA

ATGTTTTTTCTCTATTGTTCATTTGTTGGTATTACATACTTGCACCACACACACCCTTCATTGCCCCATTATGATTCAACAGAATGGGACTGGTTAAGGGGAGCTCTCTCCACCGTCGATAGAGACTATGGGATCTTGAACAGGGTGGGCCACAACATAGCTAATACCCACGTCACCCATCATTTATTCCCAAGAATTCCTCATTATCATGCGGTAGAGGCTACGAAAGCAATCAAGCCCATACTAAAAGATTATTATAG...

CDS

Download CDS FASTA

378 bp · TkA05G294910|TK1151|CDS

ATGTTTTTTCTCTATTGTTCATTTGTTGGTATTACATACTTGCACCACACACACCCTTCATTGCCCCATTATGATTCAACAGAATGGGACTGGTTAAGGGGAGCTCTCTCCACCGTCGATAGAGACTATGGGATCTTGAACAGGGTGGGCCACAACATAGCTAATACCCACGTCACCCATCATTTATTCCCAAGAATTCCTCATTATCATGCGGTAGAGGCTACGAAAGCAATCAAGCCCATACTAAAAGATTATTATAG...

Protein

Download Protein FASTA

125 aa · TkA05G294910|TK1151|PROTEIN

MFFLYCSFVGITYLHHTHPSLPHYDSTEWDWLRGALSTVDRDYGILNRVGHNIANTHVTHHLFPRIPHYHAVEATKAIKPILKDYYRFDETPVLKALYREAKECIYVESGDDEVGKGIFWFNNKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G294910`
TK1151 ID	TkA05G294910
OH-1004 ID	LXL04_020740
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.800
Protein coverage (%)	TK1151 100.000 / OH-1004 33.158 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G294910

Location Chr05:72792781-72793158 (+)

Description Similar to FAD2: Delta(12) fatty acid desaturase FAD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12120`	ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes.	Consequences of omega -6-oleate desaturase deficiency on lipid dynamics and functional properties of mitochondrial membranes of Arabidopsis thaliana.2001 · DOI: 10.1074/jbc.m006231200 Desaturation and hydroxylation. Residues 148 and 324 of Arabidopsis FAD2, in addition to substrate chain length, exert a major influence in partitioning of catalytic specificity.2002 · DOI: 10.1074/jbc.m200231200 Alternative oxidase involvement in cold stress response of Arabidopsis thaliana fad2 and FAD3+ cell suspensions altered in membrane lipid composition.2007 · DOI: 10.1093/pcp/pcm061 Arabidopsis fatty acid desaturase FAD2 is required for salt tolerance during seed germination and early seedling growth.2012 · DOI: 10.1371/journal.pone.0030355 Arabidopsis FAD2 gene encodes the enzyme that is essential for polyunsaturated lipid synthesis.1994 · DOI: 10.1105/tpc.6.1.147 Functional expression of the extraplastidial Arabidopsis thaliana oleate desaturase gene (FAD2) in Saccharomyces cerevisiae.1996 · DOI: 10.1104/pp.111.1.223

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020740 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Molecular Function

GO:0045485 omega-6 fatty acid desaturase activity Molecular Function

GO:0050184 acyl-lipid omega-6 desaturase (cytochrome b5) activity Molecular Function

GO:0102985 acyl-CoA (9+3)-desaturase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12120

gmx:547815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.898

Rank 1 · TkA05G294910 · TK1151

Cytoplasm0.074

Rank 2 · TkA05G294910 · TK1151

Mitochondrion0.042

Rank 3 · TkA05G294910 · TK1151

Cell membrane0.040

Rank 4 · TkA05G294910 · TK1151

Nucleus0.036

Rank 5 · TkA05G294910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00487FA_desaturase2-86 aa

PF26819Phage_T4_Y16C35-103 aa

PF16247DUF490443-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G294910	`PF00487`	FA_desaturase	2	86	8.6e-10	39.5
TkA05G294910	`PF26819`	Phage_T4_Y16C	35	103	0.012	16.5
TkA05G294910	`PF16247`	DUF4904	43	92	0.16	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46313`	Arabidopsis thaliana	sp\|P46313\|FAD6E_ARATH Delta(12)-fatty-acid desaturase	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card