TkA05G277780 | RubberDandelionOmics

Gene overview

TkA05G277780

Reference: TK1151 Chr: Chr05 Coordinates: 68661585-68663193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA05G277780|TK1151|cDNA

ATGGGAACTTCTGTTCCCGATTTGAAGAATTTAAATCCGAATTTGTCTGGAATCGATTGTGGACCTCATTTCTCCTTTTGCGACTTGGTGAAATCGGAGCCTGCGAATTCAGGTAATCCTTTTCCTAAAGTCGAATTAATCGATCCTACTCCTTATGAGAGCACTGTGTTGAGAATCGGGTCATTATACTCTGAATCTGTTCCGATTGAACTAAATAACCGACTGTTAACCTTTCACATATCAAATGTAGTAAGTTCTAT...

CDS

Download CDS FASTA

573 bp · TkA05G277780|TK1151|CDS

ATGGGAACTTCTGTTCCCGATTTGAAGAATTTAAATCCGAATTTGTCTGGAATCGATTGTGGACCTCATTTCTCCTTTTGCGACTTGGTGAAATCGGAGCCTGCGAATTCAGGTAATCCTTTTCCTAAAGTCGAATTAATCGATCCTACTCCTTATGAGAGCACTGTGTTGAGAATCGGGTCATTATACTCTGAATCTGTTCCGATTGAACTAAATAACCGACTGTTAACCTTTCACATATCAAATGTAGTAAGTTCTAT...

Protein

Download Protein FASTA

190 aa · TkA05G277780|TK1151|PROTEIN

MGTSVPDLKNLNPNLSGIDCGPHFSFCDLVKSEPANSGNPFPKVELIDPTPYESTVLRIGSLYSESVPIELNNRLLTFHISNVVSSMKSLKDLGLDVAKGTVTTEGSVIETIFFITRLSTGRKVEDPDLLERIRLTIINNLLKYHPGLPLLPFVFDFILFPFIHELSPNDENGSYEEDDLLVKECNLLTC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G277780`
TK1151 ID	TkA05G277780
OH-1004 ID	LXL04_019459
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 29.474 / OH-1004 26.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G277780

Location Chr05:68661585-68663193 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04740`	May be involved in feedback regulation of amino acid metabolism.	The ACR11 encodes a novel type of chloroplastic ACT domain repeat protein that is coordinately expressed with GLN2 in Arabidopsis.2011 · DOI: 10.1186/1471-2229-11-118
`At1g16880`	May be involved in feedback regulation of amino acid metabolism.	The ACR11 encodes a novel type of chloroplastic ACT domain repeat protein that is coordinately expressed with GLN2 in Arabidopsis.2011 · DOI: 10.1186/1471-2229-11-118

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P83643`	ACT domain-containing protein DS12, chloroplastic.	No verified direct reference in this release
`Os08g0242700`	ACT domain-containing protein DS12, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019459 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · TkA05G277780 · TK1151

Nucleus0.275

Rank 2 · TkA05G277780 · TK1151

Mitochondrion0.201

Rank 3 · TkA05G277780 · TK1151

Cell membrane0.121

Rank 4 · TkA05G277780 · TK1151

Plastid0.113

Rank 5 · TkA05G277780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08539HbrB61-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G277780	`PF08539`	HbrB	61	97	0.25	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ23`	Arabidopsis thaliana	sp\|Q9LZ23\|ACR12_ARATH ACT domain-containing protein ACR12	43.500%	Swiss-Prot	Medium
`Q9FZ47`	Arabidopsis thaliana	sp\|Q9FZ47\|ACR11_ARATH ACT domain-containing protein ACR11	54.700%	Swiss-Prot	Low
`P83643`	Oryza sativa subsp. indica	sp\|P83643\|UP12_ORYSI ACT domain-containing protein DS12, chloroplastic	45.000%	Swiss-Prot	Low
`Q0J709`	Oryza sativa subsp. japonica	sp\|Q0J709\|UP12_ORYSJ ACT domain-containing protein DS12, chloroplastic	45.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card