Gene Card
Gene overview
cDNA / CDS / Protein Sequences
561 bp · TkA05G251490|TK1151|cDNA
ATGGAAGACGAAATCTGGAAAGAGTTTCCGGAAGATTTACACGAGGCGGTGATCGCAAGGCTTCCGGTAGCCACCTTCTTCCGATTCCGGTCAGTGTGCCAGAAATGGAACAGTCTGCTAACTTCCAGTAGTTTCTCCATTGAATGCTCCCGACTCCCAAACCCCCAACAACCATGGTTTTACACAAGTCACGAAAACATCAACACGGGAGAGATCTACGATCCGGTCGCCGGAAAATGGCACCACCCCACCGCTCCGGC...
561 bp · TkA05G251490|TK1151|CDS
ATGGAAGACGAAATCTGGAAAGAGTTTCCGGAAGATTTACACGAGGCGGTGATCGCAAGGCTTCCGGTAGCCACCTTCTTCCGATTCCGGTCAGTGTGCCAGAAATGGAACAGTCTGCTAACTTCCAGTAGTTTCTCCATTGAATGCTCCCGACTCCCAAACCCCCAACAACCATGGTTTTACACAAGTCACGAAAACATCAACACGGGAGAGATCTACGATCCGGTCGCCGGAAAATGGCACCACCCCACCGCTCCGGC...
Protein
Download Protein FASTA186 aa · TkA05G251490|TK1151|PROTEIN
MEDEIWKEFPEDLHEAVIARLPVATFFRFRSVCQKWNSLLTSSSFSIECSRLPNPQQPWFYTSHENINTGEIYDPVAGKWHHPTAPAIPTKMIILPMAAAGGLVCFLDIGHRSFYVCNPLTRSFKELKGSRSVRVWSRVAVGMSVKQGGYGYVIMWVGSEGEYEVYDSAIDSWTCPGISKSHSRYR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G251490 |
|---|---|
| TK1151 ID | TkA05G251490 |
| OH-1004 ID | LXL04_020600 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 95.161 / OH-1004 39.509Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G251490 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:62511763-62512323 (+) | |||||||||
| Description | Similar to FBX6: F-box only protein 6 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009908 flower development Biological Process GO:0009933 meristem structural organization Biological Process GO:0010305 leaf vascular tissue pattern formation Biological Process GO:0010928 regulation of auxin mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030154 cell differentiation Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process GO:0060776 simple leaf morphogenesis Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G27340 ath:AT1G30950 ath:AT3G61590 ath:AT4G33160 ath:AT5G15710 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00646F-box6-45 aaPF12937F-box-like10-42 aaPF01344Kelch_123-38 aaPF01344Kelch_163-81 aaPF07734FBA_194-176 aaPF01344Kelch_1164-175 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G251490 | PF00646 | F-box | 6 | 45 | 1.8e-07 | 31.5 |
| TkA05G251490 | PF12937 | F-box-like | 10 | 42 | 0.031 | 14.7 |
| TkA05G251490 | PF01344 | Kelch_1 | 23 | 38 | 0.0019 | 18.4 |
| TkA05G251490 | PF01344 | Kelch_1 | 63 | 81 | 0.0019 | 18.4 |
| TkA05G251490 | PF07734 | FBA_1 | 94 | 176 | 1.5e-05 | 24.9 |
| TkA05G251490 | PF01344 | Kelch_1 | 164 | 175 | 0.0019 | 18.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.